KEGG   Halanaerobium praevalens: Hprae_0976Help
Entry
Hprae_0976        CDS       T01941                                 

Definition
carboxylesterase, putative
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hpk  Halanaerobium praevalens
Brite
Enzymes [BR:hpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Hprae_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1079599..1080393)
Genome map
AA seq 264 aa AA seqDB search
MKLNKIKSDTKINPLGQEIRLGFANKNQNKAVLLLHGFGGRSSNWNYAAQKIYQKMKIPI
YVPRLPGHATNTEDFLNSNADQWLRKAVDSYLYLASSYPQIYLAGFSMGGLLAAILAAKF
KPEKLSLVAPAFFTVNQNIVFAPYLKYFIKKIDNDFKLEKENLNKLEIDFHQNYSCYYYP
QALAELYKLMQQGRKSITKIKTPTQLILSKTDEQVATPKINDFLNKKMGRFLVDQKTYQK
SSHVIINDLKKEACTQAIINFLFD
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataaaattaagtctgataccaaaattaatcctttaggtcaagaaataaga
ttaggttttgctaataaaaatcaaaataaggcagtccttttattacatggttttggtggt
cgaagtagtaattggaattatgctgctcaaaaaatatatcaaaaaatgaagattccaatt
tatgttcctcgcttaccaggccatgctactaataccgaagattttttaaatagcaatgca
gaccagtggctgcgaaaagcagtagatagttatttatatttagctagtagttatcctcaa
atatatttagctggattttcaatgggagggcttttagcagctatacttgctgccaaattt
aagccagaaaaattatctttagttgctcctgcttttttcactgttaaccaaaatattgtt
tttgctccttatcttaaatatttcattaaaaaaatagataatgattttaaactagaaaaa
gaaaatttaaataaattggaaattgatttccatcaaaattatagttgttattattatcct
caagctctagcagaactatataaattaatgcagcaggggagaaaatcaataactaaaatt
aaaactccaactcagttaattttatctaaaactgatgagcaagtagcaactccaaaaatt
aatgactttttaaataaaaaaatgggaagatttttagtagatcaaaagacctatcaaaaa
tcatcccatgttattattaatgatcttaaaaaagaagcttgtactcaggctataataaac
tttttatttgattaa

DBGET integrated database retrieval system