KEGG   Halanaerobium praevalens: Hprae_0984Help
Entry
Hprae_0984        CDS       T01941                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
hpk  Halanaerobium praevalens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Hprae_0984
Enzymes [BR:hpk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Hprae_0984
    3.5.1.-  
     Hprae_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088008..1088604
Genome map
AA seq 198 aa AA seqDB search
MNKALIAVDLQNDFYENGNLGVKEASKINQTVNRYLAAKEYKLIVASQDWHPESHLSFAV
NHNQKPYTPYNEQKGLGPLLWPKHCVQNSEGAEFQADIETKYFDYILRKGSLKKVDSYSA
FYDNDGSDLGLAGLLKSLAVKEVDILGLAFDYCVKFTALDSIKNDFKTNIILKATKAVNK
ENVAEVKAELKEAGVNFK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctttaattgcggttgatttacaaaatgatttttatgaaaatggtaattta
ggagtaaaagaagcctctaagattaatcaaacagttaatagatatttagcagcaaaggaa
tataaactaattgtagcttcacaagattggcatccagaatctcatttaagttttgcagtt
aatcataatcaaaaaccatataccccttataatgagcagaaaggactcggacctctatta
tggcctaaacattgtgtgcaaaattctgaaggagctgagttccaagctgatatagaaact
aaatactttgattatatattaagaaaaggtagtttaaagaaagtagatagttattctgct
ttttatgataatgatgggagtgatttgggtttagccggcttattaaagtctttagcagtt
aaagaagtagatattttaggtttagcatttgattattgtgttaaatttactgctttagat
agtattaaaaatgattttaaaacaaatattattttaaaggcaactaaagctgtcaataaa
gaaaatgtagctgaggttaaagcagaattaaaagaggcaggagtcaactttaaataa

DBGET integrated database retrieval system