KEGG   Halanaerobium praevalens: Hprae_0984Help
Entry
Hprae_0984        CDS       T01941                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
hpk  Halanaerobium praevalens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hpk00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088008..1088604
Genome map
AA seq 198 aa AA seqDB search
MNKALIAVDLQNDFYENGNLGVKEASKINQTVNRYLAAKEYKLIVASQDWHPESHLSFAV
NHNQKPYTPYNEQKGLGPLLWPKHCVQNSEGAEFQADIETKYFDYILRKGSLKKVDSYSA
FYDNDGSDLGLAGLLKSLAVKEVDILGLAFDYCVKFTALDSIKNDFKTNIILKATKAVNK
ENVAEVKAELKEAGVNFK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctttaattgcggttgatttacaaaatgatttttatgaaaatggtaattta
ggagtaaaagaagcctctaagattaatcaaacagttaatagatatttagcagcaaaggaa
tataaactaattgtagcttcacaagattggcatccagaatctcatttaagttttgcagtt
aatcataatcaaaaaccatataccccttataatgagcagaaaggactcggacctctatta
tggcctaaacattgtgtgcaaaattctgaaggagctgagttccaagctgatatagaaact
aaatactttgattatatattaagaaaaggtagtttaaagaaagtagatagttattctgct
ttttatgataatgatgggagtgatttgggtttagccggcttattaaagtctttagcagtt
aaagaagtagatattttaggtttagcatttgattattgtgttaaatttactgctttagat
agtattaaaaatgattttaaaacaaatattattttaaaggcaactaaagctgtcaataaa
gaaaatgtagctgaggttaaagcagaattaaaagaggcaggagtcaactttaaataa

DBGET integrated database retrieval system