KEGG   Halanaerobium praevalens: Hprae_1126Help
Entry
Hprae_1126        CDS       T01941                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hprae_1126
Enzymes [BR:hpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hprae_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ADO77277
UniProt: E3DLT0
Position
complement(1256846..1257763)
Genome map
AA seq 305 aa AA seqDB search
MSKILVIGSMNMDLVVQTERYPEAGETIIGGKFAQIPGGKGANQALAAAKLGDEVQFIGA
CGDDSFAPMLKSSLKNGGAKIDNIFEIKDKSTGVAVITVDPEGNNRIIVSPGANYELDLA
KIEKIKSQIIEAEIILLQLEIPVETIAKIVEIAAANNTKIILDPAPAQQLSDHILSEIDF
LLPNEGELDLLMAAADAKTRSEKIEILLDKGVKNIIVTEGEKGLNFYNKEQALHLDALKV
KAVDTTAAGDVFAGAFAASLISENDLEKSLKCAVQAAAYSVSKRGAQSSIPDQNELNEFL
AERSN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattcttgttattggaagtatgaatatggatttagttgttcaaactgaacgc
tatccagaagcaggagaaactataattggtggtaaatttgcacaaattccaggtggtaaa
ggagcaaatcaggctctagcagcagcaaagttgggagatgaggttcaatttattggcgct
tgtggagatgacagttttgctcctatgttaaaatcaagtttaaaaaatggtggagccaaa
attgataatatttttgagattaaagacaaaagtacaggtgttgcagtcattactgttgac
ccagaaggaaataatagaattatagtttcgcctggagcaaattatgaattagatctagct
aaaattgaaaaaattaagtctcaaattattgaagctgaaattatactgctgcagctggaa
attcctgttgaaactattgcaaaaatcgtagaaattgctgcagccaataatacaaaaatc
attttagatccagctccagcgcaacaattatctgatcatattttatctgaaatagatttt
ttactgccaaatgaaggtgaacttgatttattaatggctgctgctgatgctaaaactcgt
tcagaaaaaattgagattttacttgataaaggtgtgaaaaacattattgtgactgaggga
gaaaaaggtctcaacttttataataaagagcaagcacttcatttagatgctctaaaagtt
aaagcagtagatacaacagctgctggcgatgtttttgcaggtgcttttgcagccagtttg
atttcggaaaatgatctggaaaaatctttaaaatgtgctgttcaagctgcagcttattca
gttagcaaaagaggtgctcagagttctataccagatcaaaatgaattaaatgaattcctt
gcagaaaggagtaactaa

DBGET integrated database retrieval system