KEGG   Halanaerobium praevalens: Hprae_1126Help
Entry
Hprae_1126        CDS       T01941                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hpk  Halanaerobium praevalens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hprae_1126
Enzymes [BR:hpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hprae_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1256846..1257763)
Genome map
AA seq 305 aa AA seqDB search
MSKILVIGSMNMDLVVQTERYPEAGETIIGGKFAQIPGGKGANQALAAAKLGDEVQFIGA
CGDDSFAPMLKSSLKNGGAKIDNIFEIKDKSTGVAVITVDPEGNNRIIVSPGANYELDLA
KIEKIKSQIIEAEIILLQLEIPVETIAKIVEIAAANNTKIILDPAPAQQLSDHILSEIDF
LLPNEGELDLLMAAADAKTRSEKIEILLDKGVKNIIVTEGEKGLNFYNKEQALHLDALKV
KAVDTTAAGDVFAGAFAASLISENDLEKSLKCAVQAAAYSVSKRGAQSSIPDQNELNEFL
AERSN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattcttgttattggaagtatgaatatggatttagttgttcaaactgaacgc
tatccagaagcaggagaaactataattggtggtaaatttgcacaaattccaggtggtaaa
ggagcaaatcaggctctagcagcagcaaagttgggagatgaggttcaatttattggcgct
tgtggagatgacagttttgctcctatgttaaaatcaagtttaaaaaatggtggagccaaa
attgataatatttttgagattaaagacaaaagtacaggtgttgcagtcattactgttgac
ccagaaggaaataatagaattatagtttcgcctggagcaaattatgaattagatctagct
aaaattgaaaaaattaagtctcaaattattgaagctgaaattatactgctgcagctggaa
attcctgttgaaactattgcaaaaatcgtagaaattgctgcagccaataatacaaaaatc
attttagatccagctccagcgcaacaattatctgatcatattttatctgaaatagatttt
ttactgccaaatgaaggtgaacttgatttattaatggctgctgctgatgctaaaactcgt
tcagaaaaaattgagattttacttgataaaggtgtgaaaaacattattgtgactgaggga
gaaaaaggtctcaacttttataataaagagcaagcacttcatttagatgctctaaaagtt
aaagcagtagatacaacagctgctggcgatgtttttgcaggtgcttttgcagccagtttg
atttcggaaaatgatctggaaaaatctttaaaatgtgctgttcaagctgcagcttattca
gttagcaaaagaggtgctcagagttctataccagatcaaaatgaattaaatgaattcctt
gcagaaaggagtaactaa

DBGET integrated database retrieval system