KEGG   Halanaerobium praevalens: Hprae_1209Help
Entry
Hprae_1209        CDS       T01941                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00010  Glycolysis / Gluconeogenesis
hpk00030  Pentose phosphate pathway
hpk00051  Fructose and mannose metabolism
hpk00680  Methane metabolism
hpk01100  Metabolic pathways
hpk01110  Biosynthesis of secondary metabolites
hpk01120  Microbial metabolism in diverse environments
hpk01130  Biosynthesis of antibiotics
hpk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hprae_1209
   00030 Pentose phosphate pathway
    Hprae_1209
   00051 Fructose and mannose metabolism
    Hprae_1209
  Energy metabolism
   00680 Methane metabolism
    Hprae_1209
Enzymes [BR:hpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Hprae_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: ADO77347
UniProt: E3DM69
Position
complement(1341249..1343198)
Genome map
AA seq 649 aa AA seqDB search
MEAEKYLELLSENFPNIPAVSTEIINLKAILNLPKSTEHFLTDLHAEDEAFQYMLKTASG
VIEYKIDQAFDLSQAEKNELATLIFYPEEKLEKLKANQAKLGAAEYQKFLNQIIKLSKDV
SSIYTRSKVRKALPEEFAYIIEELLHLKKDSKNKKDYHDQIVKTIIEIGQAENFIISLAQ
LIQTFAVDKLHIVGDIFDRGPNPHKIMDVLKNHHDVDLQWGNHDILWMGAGLGQKALIAT
AVRISLRYGNLELLEEGYRINMRPLARLARNYYQDFKGEIFCPKLIERDINDQDKDISAQ
MQKAIAIIQFKLEGQLIKSRPEFKMNEALYLEKIDYKRGILTLNEQEYPLIDNHFPTIDP
KNPYQLNEQEQEVIDHLSNSFQNNDRLQEDIRFIFNNGSMYKKYNGNLLFHGCVPLKQNG
DFAEIEVEAKKVKGKKLLDFFQDVVRHSYSTKTKRKDKRDWLWYLWRGEYSPLFGKDRMT
TFLRYFTDEDDKELYQENKNPYYSLREKEEICNKILKEFEMDPEQGVIINGHTPVEEKRG
ESPIKGQGKLLVIDGGISAAYHKKTGIAGYTLIYSDSEMRLISHKPFVSKAEVLKKGTKD
TLASKVVKKFEPAKKISDTDIGIKLKDDIKYLEKLLKAYQNGTIKEKYN
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaaaaatatttagaacttttatcagagaacttccctaatattccagcagtt
agtactgaaattattaatttaaaggctattttaaatttacctaaaagtactgaacatttt
ttaacagatttgcatgctgaagatgaagcatttcaatatatgctcaaaactgcttcagga
gttattgaatataaaatagatcaagcttttgatttaagtcaagcagaaaaaaatgaatta
gcaactttaattttttatccagaagaaaaattagaaaaattaaaagcgaatcaggctaag
cttggggcagctgaataccaaaaatttttaaatcaaataataaaactctctaaagatgta
tcttctatttatactagatcaaaagtcaggaaagctctaccagaagaatttgcttatatt
atcgaagaacttctgcacctaaaaaaagatagtaaaaacaaaaaagattatcatgatcaa
attgtaaaaacaattattgaaattggtcaagctgaaaactttattatttctttagcccag
ctaatccaaacttttgcagttgataaattgcatatagtaggagatatatttgatcgaggt
ccaaatccacataaaattatggacgttttaaaaaatcaccatgatgtcgacttacaatgg
ggaaaccatgatatattgtggatgggagcaggtcttggtcaaaaagcattaattgcaaca
gcagttagaattagtttgagatatggtaatttagagctcttagaagaaggttatagaatt
aatatgagacctttagccagattagccagaaattattatcaagattttaagggagaaatt
ttttgtcctaaattaatagaaagagatattaatgatcaagataaagatatcagtgctcaa
atgcaaaaagcaattgctattattcaatttaaattagaaggccaattaattaaaagcaga
cctgaatttaaaatgaatgaagccctctatttagaaaaaatagattataaaagaggtatt
ttaactttaaatgagcaagaatatcctttaattgataatcattttccgacaatcgatcct
aaaaatccctatcaattaaatgagcaagaacaagaagtaatagatcatttaagtaattct
tttcaaaataatgatagattacaggaagatattagatttatttttaataatggaagtatg
tataaaaaatataatggaaatctgttatttcatggttgtgtacctttaaagcaaaatggg
gattttgctgaaattgaggtggaagctaaaaaagttaagggtaaaaaattacttgatttc
tttcaggatgtagttagacatagttattcaactaaaacaaagagaaaagataaacgtgac
tggttatggtatctctggcgaggagaatactctcctctttttggtaaagatagaatgact
acttttttaagatattttactgatgaggatgataaagaactttatcaagaaaataaaaat
ccatattattctttgagagaaaaggaagaaatttgtaataaaatattaaaggaatttgag
atggatcctgagcagggagttattattaatggtcatactccagttgaagaaaaaagagga
gaaagtccaattaaaggccagggaaaattattagtaattgatggtggaatttctgctgct
tatcataaaaaaactggtatagctggctatactttaatttatagtgactcagaaatgaga
ctgatttctcataaaccgtttgtatctaaagcagaagtgctcaaaaaaggaacaaaagat
acacttgcttctaaagttgtaaaaaagtttgagccagccaagaaaatttcagatacagat
ataggaattaaattaaaagatgatattaagtatctagaaaaattactaaaagcttatcaa
aatggaactattaaagaaaaatataattaa

DBGET integrated database retrieval system