KEGG   Halanaerobium praevalens: Hprae_1475Help
Entry
Hprae_1475        CDS       T01941                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4 5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hpk  Halanaerobium praevalens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hprae_1475
   01230 Biosynthesis of amino acids
    Hprae_1475
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hprae_1475
  Energy metabolism
   00680 Methane metabolism
    Hprae_1475
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hprae_1475
Enzymes [BR:hpk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Hprae_1475
Exosome [BR:hpk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Hprae_1475
  Exosomal proteins of melanoma cells
   Hprae_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1628296..1629036)
Genome map
AA seq 246 aa AA seqDB search
MKIVLVRHGESKWNLANKFTGWTDVDLSKQGYQEAKEAGELLKKEGFSFDLAYTSYLKRA
TKTLNIILDIMDLHWIPVNKSWKLNERHYGALQGLNKAETAKKEGAEQVHIWRRSFDTPP
PALDQADQRYPGNEAKYAELSEKQLPRAESLKMTIERVMPYWENEIVPQMKKGKKIIVAA
HGNSLRALVKHLDGISDSDIPSLNIPTGKPLVYEFDQAMEVKAKYYLGDQEEIKKEMAKV
KNQAKK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtattagttcgccatggagaaagtaaatggaatttagctaataagtttaca
ggttggacagatgtagatttaagtaaacaaggttatcaagaggcaaaagaagctggagaa
ttattaaaaaaagagggctttagctttgatttagcttatacatcttatttaaaacgtgcc
acaaaaactttaaatataattttagatattatggatttgcattggattccagttaataaa
tcttggaagttaaatgaaagacattatggagctttacaaggactgaataaagcagaaact
gctaaaaaagaaggagcagagcaggttcatatttggcggcgtagttttgatacacctcca
cctgctttagatcaagctgatcagcgttatcctggtaatgaagctaaatatgctgaatta
agtgaaaaacagctacctagagctgagagtttaaaaatgacaatcgaaagagtaatgcct
tattgggaaaatgaaattgtaccacagatgaaaaaaggcaaaaagattattgttgctgct
catggtaatagtttaagagctttagtcaaacatttagatggaatttctgattcagatatt
ccgagtcttaatattccaacaggaaaaccattagtttatgaatttgaccaagcaatggaa
gtaaaagctaaatattatcttggtgatcaagaggaaataaaaaaagaaatggccaaagta
aaaaatcaagctaaaaaataa

DBGET integrated database retrieval system