KEGG   Halanaerobium praevalens: Hprae_1475Help
Entry
Hprae_1475        CDS       T01941                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00010  Glycolysis / Gluconeogenesis
hpk00260  Glycine, serine and threonine metabolism
hpk00680  Methane metabolism
hpk01100  Metabolic pathways
hpk01110  Biosynthesis of secondary metabolites
hpk01120  Microbial metabolism in diverse environments
hpk01130  Biosynthesis of antibiotics
hpk01200  Carbon metabolism
hpk01230  Biosynthesis of amino acids
Module
hpk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hpk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hprae_1475
  Energy metabolism
   00680 Methane metabolism
    Hprae_1475
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hprae_1475
Enzymes [BR:hpk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Hprae_1475
Membrane trafficking [BR:hpk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Hprae_1475
Exosome [BR:hpk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Hprae_1475
  Exosomal proteins of melanoma cells
   Hprae_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADO77602
UniProt: E3DNQ2
Position
complement(1628296..1629036)
Genome map
AA seq 246 aa AA seqDB search
MKIVLVRHGESKWNLANKFTGWTDVDLSKQGYQEAKEAGELLKKEGFSFDLAYTSYLKRA
TKTLNIILDIMDLHWIPVNKSWKLNERHYGALQGLNKAETAKKEGAEQVHIWRRSFDTPP
PALDQADQRYPGNEAKYAELSEKQLPRAESLKMTIERVMPYWENEIVPQMKKGKKIIVAA
HGNSLRALVKHLDGISDSDIPSLNIPTGKPLVYEFDQAMEVKAKYYLGDQEEIKKEMAKV
KNQAKK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtattagttcgccatggagaaagtaaatggaatttagctaataagtttaca
ggttggacagatgtagatttaagtaaacaaggttatcaagaggcaaaagaagctggagaa
ttattaaaaaaagagggctttagctttgatttagcttatacatcttatttaaaacgtgcc
acaaaaactttaaatataattttagatattatggatttgcattggattccagttaataaa
tcttggaagttaaatgaaagacattatggagctttacaaggactgaataaagcagaaact
gctaaaaaagaaggagcagagcaggttcatatttggcggcgtagttttgatacacctcca
cctgctttagatcaagctgatcagcgttatcctggtaatgaagctaaatatgctgaatta
agtgaaaaacagctacctagagctgagagtttaaaaatgacaatcgaaagagtaatgcct
tattgggaaaatgaaattgtaccacagatgaaaaaaggcaaaaagattattgttgctgct
catggtaatagtttaagagctttagtcaaacatttagatggaatttctgattcagatatt
ccgagtcttaatattccaacaggaaaaccattagtttatgaatttgaccaagcaatggaa
gtaaaagctaaatattatcttggtgatcaagaggaaataaaaaaagaaatggccaaagta
aaaaatcaagctaaaaaataa

DBGET integrated database retrieval system