KEGG   Halanaerobium praevalens: Hprae_1708Help
Entry
Hprae_1708        CDS       T01941                                 

Definition
glutamyl-tRNA synthetase; glutamate--tRNA(Gln) ligase (EC:6.1.1.17 6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
hpk  Halanaerobium praevalens
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hprae_1708
Enzymes [BR:hpk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Hprae_1708
Amino acid related enzymes [BR:hpk01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Hprae_1708
Transfer RNA biogenesis [BR:hpk03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Hprae_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1866436..1867911)
Genome map
AA seq 491 aa AA seqDB search
MSNNIRLRFPPSPTGKIHIGNMRTALFNWLVTKQKDGELVLRIEDTDQARSTKEFEEIII
QEMEWLNLDADEGVGIGGDYGPYRQTERIDLYQEYADKLLEKGYAYKCYCTKDELDQMRQ
KAIDNDQMPRYDGSCRHLTESEQKAYEKEGRKPVLRFKLPEKEREIIVQDLIRGDVSFNS
SVLDDFIIFKSDGMPTYNFAVVIDDALMKISHVIRGEDHLSNTPKQILIYEALDFELPKF
AHLPLILDENKAKLKKRGKDSVYIGEFREQGYLPEALFNFMALLGWSSGDEEEILSQSEI
IERFAIEDVNKSGAVFDREKLNWMNGKYIRAAELDRIVDLAIPFLLEAELVDEEYVANNR
EWLAKVIDETRTGLDYLAQIPAEAELFLTEIEFNDSAEAAAEFKGEDVKLVFETLKEKMF
SRSELTAAAVGEIFKELKNELDVGGRTIYHPTRLAITGKTSGPEMTSVISIFGAEETANR
LDSALNLAQNS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataatataagattgcgttttcccccaagtccgactgggaaaattcatattggt
aatatgagaacagcgctttttaattggttagtgacaaaacaaaaagatggggaactcgtt
ttaagaattgaagatacagatcaggctagatcaactaaagagtttgaagaaattattatt
caagaaatggaatggttaaatcttgatgccgatgaaggtgttggtattggtggagattat
ggtccttatcgacagactgaaagaattgatctttatcaagaatatgccgataaattatta
gaaaaaggctatgcatataagtgttattgtactaaagatgagcttgatcaaatgagacaa
aaagctatcgataatgatcagatgcctcgttatgatggttcttgtagacatctaactgaa
tctgagcaaaaggcttatgaaaaagagggcagaaagccagtattacgctttaaattacct
gagaaagaaagagaaataattgttcaagacttaattaggggtgatgttagtttcaattct
tctgttttagatgattttataatttttaaatcagatggaatgcctacttataattttgca
gtagttattgatgatgctctaatgaaaatttcacatgttattagaggtgaagatcatctt
tctaatactccaaaacaaatcttaatttatgaagctttagattttgaactacctaaattt
gctcatttacctttgattttagatgaaaataaagctaagcttaaaaaaagaggtaaggat
tctgtttatatcggagaatttagagaacagggatatttaccagaagcattatttaatttt
atggctcttttgggttggtcaagtggtgatgaggaagaaatactttctcaaagtgagatt
attgaacgttttgcaattgaagatgtaaataaaagtggagctgtatttgatcgagaaaag
ctaaattggatgaatggtaaatatattagagcagctgaattagatcgaatagtagattta
gcaattccatttttgttagaagccgagctcgttgatgaagaatatgtagccaataatcga
gaatggttagctaaagtgattgatgaaactaggacaggtcttgattatttagctcaaatt
ccagctgaagctgagcttttcttaacagaaattgaatttaatgattcagctgaggctgct
gcagaatttaaaggagaagatgttaaattagtttttgaaactctaaaagaaaaaatgttt
tctcgttcagaattaactgctgcagcggttggagaaattttcaaagaattaaaaaatgaa
cttgatgttggtggtagaacaatttatcatccaacaagacttgctataacaggcaagact
tctggtcctgaaatgactagtgtaatttcaatttttggagctgaagaaactgctaataga
ttagattctgctttaaatttagctcaaaacagttaa

DBGET integrated database retrieval system