KEGG   Halanaerobium praevalens: Hprae_1924Help
Entry
Hprae_1924        CDS       T01941                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpk  Halanaerobium praevalens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hprae_1924
   00052 Galactose metabolism
    Hprae_1924
   00500 Starch and sucrose metabolism
    Hprae_1924
   00520 Amino sugar and nucleotide sugar metabolism
    Hprae_1924
Enzymes [BR:hpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hprae_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2112585..2113457)
Genome map
AA seq 290 aa AA seqDB search
MKVKKAVIPAAGWGTRLLPATKAQPKEMLPIVDKPAIQYIVEEAVAAGIEDILIITSKDK
ESLENHFDKSPALEQALEKQGKSELLKQVKSISEMITIHSVRQKEQKGLGHAIACAQSFV
GNEPFAVLLGDDIIQAEEPVIKQMMDVYAQKQAAVLGCKTVAEKDVSKYGIVAYSKKEGD
IYQVEDLIEKPAVEKAPSKLAILGRYIITPEIFDILAETEAGKGGEIQLTDALKTLLAQQ
KVYGYDFKGQRYDVGNKMGFLKTTVELALAHQDLGAEFKAYLKELTAELE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaagcggtaattccagctgcaggctggggaactagattacttcctgct
actaaagcacaaccaaaagaaatgctgccaatagttgataaaccagctatccagtacata
gtcgaagaagctgtggcagctgggatagaagatattttaataatcacctcaaaagataaa
gaaagtttagaaaatcattttgataaatctcctgccttagaacaggctttagaaaaacag
ggtaaaagtgaattattaaagcaagttaaatctatttctgaaatgattactattcactca
gttcgtcaaaaagaacaaaaaggtttaggtcatgctattgcctgtgctcaaagttttgtt
gggaatgaaccttttgctgttttattaggtgatgatattattcaagctgaagaaccagta
attaaacaaatgatggatgtttatgctcaaaaacaagctgcggttttaggttgtaaaaca
gtagctgaaaaagatgttagtaaatatgggattgttgcttatagtaaaaaagaaggtgat
atttatcaggttgaggatttaattgaaaaaccagcagttgaaaaagcaccttctaaatta
gctattttagggcgttatataattacacctgagatttttgatattttagcagaaactgaa
gctggtaaaggtggagaaattcagctcacagatgctttaaaaactttacttgctcaacaa
aaagtttatggctatgattttaaaggtcagcgctatgatgttggcaataaaatgggattt
ttaaaaacaactgttgagctggctttagctcatcaagatttaggagctgagtttaaagct
tatctaaaagagttaacagcagaattagaataa

DBGET integrated database retrieval system