KEGG   Halanaerobium praevalens: Hprae_1957Help
Entry
Hprae_1957        CDS       T01941                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyl transferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hpk  Halanaerobium praevalens
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2154675..2155925)
Genome map
AA seq 416 aa AA seqDB search
MEKYVIEGLNSLAGEIKVGGAKNAALPIIAASLLADSEVILTDIPRLRDVTNLCSIIRDM
GAKVETNKNQITIDPRLVNKTEADHNLARKLRASYYILGVMLAKSGHARTTLPGGCNIGN
RPIDLHLKGFRALGAEVNLDHGVVDVKANKLSGADIYLDYPSVGATINIMIAASRAEGQT
IIENAAREPEIVDLANFLTVMGAKIKGVGTDIIKIEGVDEMHGVEHRIIPDRIEAGTYMI
ASAITAGDVFVRNVLTEHVKPLIAKMHEMGIVVEEDIAGVRVKATKDLKAVDVKTLPYPG
FPTDMQSQMMALLTQADETSLIIETVWENRFMHVDELKRMGANIKIDGHSALIKPGRLSG
AEVKATDLRAGAALILAGLAAEGQTEVRDIYHVERGYENIEKKLSQVGASINKVSE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagtatgttattgaaggtttaaactcacttgctggagaaattaaagttggagga
gcaaaaaatgcagctttgccgattatagcagcttcattacttgctgattctgaagtaatt
ttaactgatattcctcggctgagagatgtaacaaatttatgtagtattattcgtgatatg
ggagcaaaagtagaaactaataaaaatcaaattacaattgatcctaggctagttaataag
acagaagctgatcataatttagctcggaaattaagggcttcctactatattttaggagta
atgctagctaagtctggccatgccagaacaactttgcctggaggttgtaatataggtaat
cgccccattgatctccacttaaaaggttttagagctctaggagcagaggttaatttagat
cacggagtagttgatgttaaggcaaataaattaagcggggcagatatttatttggattat
ccaagtgtaggggccactattaatattatgattgctgctagtcgcgccgaaggtcaaaca
ataattgaaaatgcagcccgagaaccagaaattgttgatttagctaactttttgactgtt
atgggcgctaaaattaaaggtgtaggtacagatattataaaaattgaaggtgtagatgag
atgcatggagttgagcatcggattatacctgatagaattgaagcaggtacatatatgatt
gcctctgctatcacagcaggtgatgtttttgtgagaaatgttttgactgaacatgtaaaa
ccattaattgctaaaatgcatgagatgggaattgtagttgaagaagatatagcaggtgtg
agagtcaaagcaactaaagatttaaaagcagttgacgttaaaactttgccttatcctggt
tttccaacagatatgcagtcacaaatgatggcccttttgactcaggctgatgaaacaagt
ttaatcattgaaaccgtttgggaaaatcgctttatgcatgttgatgaattaaaaagaatg
ggagcaaatattaagattgatggacatagtgctttaatcaaacctggtcgcttgtcaggt
gctgaagtaaaggctacagacttaagagcaggagctgcccttattttagctggtctggct
gctgaaggccaaactgaagttagagatatttaccatgtagagcgcggctatgaaaatata
gaaaaaaagctctcccaagttggagcttccataaataaagtatctgagtaa

DBGET integrated database retrieval system