KEGG   Helicobacter pylori B8: HPB8_1163Help
Entry
HPB8_1163         CDS       T01262                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00010  Glycolysis / Gluconeogenesis
hpl00620  Pyruvate metabolism
hpl00640  Propanoate metabolism
hpl00680  Methane metabolism
hpl01100  Metabolic pathways
hpl01110  Biosynthesis of secondary metabolites
hpl01120  Microbial metabolism in diverse environments
hpl01130  Biosynthesis of antibiotics
hpl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB8_1163 (acsA)
   00620 Pyruvate metabolism
    HPB8_1163 (acsA)
   00640 Propanoate metabolism
    HPB8_1163 (acsA)
  Energy metabolism
   00680 Methane metabolism
    HPB8_1163 (acsA)
Enzymes [BR:hpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPB8_1163 (acsA)
Lipid biosynthesis proteins [BR:hpl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPB8_1163 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBI66720
UniProt: D7FEW3
Position
1138975..1140963
Genome map
AA seq 662 aa AA seqDB search
MQLDEDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCTTLPLPGIHAEVLNEDGTKTKPGEQGFLCITKPWPSMV
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDAIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIAQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacgaagatttagaattcgctaaaaaaatctttaaccctaacagagcgttt
gccaagcaagccaggattaaaaacatgtgcgaatataaggatttggtgcatgaagccaat
gaagattacgaacatttttggggcgagttagccaagcaaaaactcacatggtttaaacct
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaaa
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgacaga
gtcattatctatatgcccatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttgagggatagg
atcaacgacgctcaagccaaattagttatcacagcggatgggacttttagaaaaggcaaa
ccctatatgctcaagccagcccttgacaaggctctagaaaataatgcctgccctagcgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttattcttgctctatacaagcggatcaaccgggaaacctaaaggcgtt
caacacagcagtgcagggtatttgctatgggcgcaaatgacgatggagtgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggttggatcacagggcacact
tatgtggtttatggacctttagcttgcggggcaacgactttgatactagaaggcacgatg
tcttatccggattatgggagatggtggaggatgatagaagaataccgcgtggataaattc
tacacttcccccaccgctataagaatgctgcatgctaaaggcgaaaacgaacccttaaag
tataatttagaatcgctcaaagttttaggaacggtgggagagcccattaaccctacggca
tggaaatggttttatgaaaaaatcggcaactcaaaatgcagtatcgtggatacttggtgg
cagacagaaacaggcgggcatatcatcagccctttaccgggagctacgcctataagggcc
agctgcacaactttacctttgcctggaatccatgcagaagttttaaacgaagacggcacc
aaaacaaagcccggagagcaagggtttttatgcatcactaagccatggccttctatggta
agaaacatttggggcgatgaaaaacgatacattgatagctatttttctcagatcaagttg
aatggggaatatgtctacctctctggagatggcgctatcgtagatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagtgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggttgaatgtgcagtagtgggtatc
cctgatgcgattaaaggagagggcttgtttgcgtttgtggtgctgtgcgatggggctaaa
tgcaatcttggcgagagtttagaattgttaaaagaaatgaatcatatcttatccgttgaa
attggaaagatcgctaaattagacaatgtcatgtatgtgccaggtttgcctaaaaccagg
agcgggaaaatcatgagaaggcttttgaaatctatcgccaaaaaagagcccatcactcaa
gatttaagcacactagaagatgtgaatgtggttaaagaaataatgagtatcgctcaaatg
gaggagtaa

DBGET integrated database retrieval system