KEGG   Helicobacter pylori B8: HPB8_1244Help
Entry
HPB8_1244         CDS       T01262                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00230  Purine metabolism
hpl01100  Metabolic pathways
Module
hpl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPB8_1244 (gmk)
Enzymes [BR:hpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HPB8_1244 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 Thymidylate_kin AAA_17 MMR_HSR1 RNA_helicase ABC_tran RsgA_GTPase ADK AAA_22 AAA_5 dNK AAA_33 CPT Rad17 AAA_29 T2SSE Podovirus_Gp16 NTPase_1 Cytidylate_kin AAA_28 DUF1981 Zeta_toxin APS_kinase TsaE NACHT Mg_chelatase AAA_30
Motif
Other DBs
NCBI-ProteinID: CBI66801
UniProt: D7FF44
Position
1213957..1214577
Genome map
AA seq 206 aa AA seqDB search
MHNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRKPREGEVDGLHYNFVSEEE
FKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSV
FISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLESFDYLIINEDLEKSKEIILS
IAKTLVHRLKAFNFEKICKAWKNESL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgattttaatttactcatcctttcaggccctagcggagcgggtaaaagcacc
cttacaaagtatttgcaagaaaaaatccccaaaacccatttttccctttccaccaccacg
agaaaacccagagagggcgaagttgatggcttgcattataattttgtcagcgaagaagaa
ttcaaacaaggcatagaaaaagggcagtttttagaatgggcgatcgtgcataaccactac
tatggcacttctaaaatccctgtagaaaaagccttaaaagagggcaaaatcgtcattttt
gatattgatgtgcaagggcatgagatccttaaaaagcattaccctaatgcatgctctgtg
tttattagcaccaaaaaccaagagattttaaaagagcgcttgcttttaagggggacggat
tctaaagagacgatagaaaagcgcttgatcaacgcttataaagaaatgcagtgcttggag
agctttgattacctcatcatcaatgaagatttagaaaaatccaaagaaatcatcttaagc
atcgcaaaaactttagtccatcgcttaaaagcgtttaattttgaaaaaatatgcaaggct
tggaaaaacgaatccttataa

DBGET integrated database retrieval system