KEGG   Helicobacter pylori B8: HPB8_1334Help
Entry
HPB8_1334         CDS       T01262                                 

Gene name
dsbC3
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpl  Helicobacter pylori B8
Brite
Enzymes [BR:hpl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPB8_1334 (dsbC3)
Secretion system [BR:hpl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPB8_1334 (dsbC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1306216..1307013)
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSEDVQLVAETNQKVQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENVTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatatcccgctcgtggtgagt
aaggatggtaatttagtcatagggcttagcaacatcttctttagcaataaaagcgaagat
gtgcaattagttgcagaaaccaatcaaaaagttcaagcccttaacgccacccaacaaaac
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgcaaataaggataaaatcctttatattgtctctgatcccatgtgccct
cattgccaaaaagagctcactaaactcagagaccacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgcccaaaaagagcctgaagatttacgcactaaa
gtggaaaatgttacgaaaaagatttttgaatctggcgtgattaagggtgtgcctttcttg
tatcattataaggcatga

DBGET integrated database retrieval system