KEGG   Helicobacter pylori B8: HPB8_1373Help
Entry
HPB8_1373         CDS       T01262                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00010  Glycolysis / Gluconeogenesis
hpl00051  Fructose and mannose metabolism
hpl01100  Metabolic pathways
hpl01110  Biosynthesis of secondary metabolites
hpl01120  Microbial metabolism in diverse environments
hpl01130  Biosynthesis of antibiotics
hpl01200  Carbon metabolism
hpl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB8_1373 (tpiA)
   00051 Fructose and mannose metabolism
    HPB8_1373 (tpiA)
   00562 Inositol phosphate metabolism
    HPB8_1373 (tpiA)
Enzymes [BR:hpl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPB8_1373 (tpiA)
Exosome [BR:hpl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPB8_1373 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPB8_1373 (tpiA)
  Exosomal proteins of melanoma cells
   HPB8_1373 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBI66930
UniProt: D7FFH3
Structure
PDB: 

Jmol
Position
complement(1345215..1345919)
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPKDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKDKNFKIVY
CIGEDLTTREKGFKAVKEFLSEQLETIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNIQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaatttcaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagcgcaaaac
gcttaccctaaggattgtggggcttttaccggtgaaatcacttccaagcatttagaagaa
ttaaaaatccacacgcttttaatagggcatagcgagagacgagcgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaagataaaaattttaaaattgtctat
tgcattggcgaagatttaacgaccagagaaaagggctttaaggctgtaaaggaattttta
agcgagcaattagaaactatcgatctcaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagatatttacctcacgcatggt
tttttaaagcaaatcttaaaccaaaaaacgcctttattgtatggggggagcgtgaatata
caaaatgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system