KEGG   Helicobacter pylori B8: HPB8_1453Help
Entry
HPB8_1453         CDS       T01262                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpl  Helicobacter pylori B8
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpl00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1422641..1423279)
Genome map
AA seq 212 aa AA seqDB search
MINMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASQDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattggcgcaaatcaatttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaagatagattaccgctggaaagaagcgagc
caagattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tacgcgcgccctccttatagtttggcgtattccttgcgccacaaccgattgctccctagg
gattatctagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaattgcaagagagtaagaaa
tattttgttttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system