KEGG   Helicobacter pylori B8: HPB8_1468Help
Entry
HPB8_1468         CDS       T01262                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpl  Helicobacter pylori B8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPB8_1468 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPB8_1468 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPB8_1468 (thrC)
Enzymes [BR:hpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPB8_1468 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439172..1440632
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLERFETLEWQDCLSMSYSELVEHVFELL
NLEIPKNLLASALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGIPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFSLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
KTTLLALNEQKKNDNDKAALETLKNSYNTPDSQRLDDLFERGIKHQEVLKLNEIKSSILL
WLESLH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgctctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcgttttgaaacattagaa
tggcaagattgtttgagcatgagctatagcgaattagtagagcatgtgtttgagctttta
aatttagaaatccctaaaaatttactggcaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaacccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttgcagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgctcgtttctaccagtggtgat
accggccctgcgactttagaaagtttggcgggcatacctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgaggctttaaaagcacgccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgcattaggggcgttttatgccaaaaaaatgggcttgaatatc
gctaaaatcaaggtcgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccaccgctctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttagcctttttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttatgcgttaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaattcaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaaccaacgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
aaaaccacccttttagccctaaacgagcaaaagaaaaacgataacgataaagccgcccta
gaaacgcttaaaaacagctacaataccccggatagccaacgccttgatgatttgtttgaa
agagggatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctattcttttg
tggctagaaagcctacattaa

DBGET integrated database retrieval system