KEGG   Helicobacter pylori B8: HPB8_1701Help
Entry
HPB8_1701         CDS       T01262                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpl  Helicobacter pylori B8
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPB8_1701 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPB8_1701 (rocF)
Enzymes [BR:hpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPB8_1701 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1658692..1659660
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREVLSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELEIPLFSVGAIRENMQGVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELRQLLGLLLESFKDRLGALEVTEYNPTVSTKHNNEEEKQVLE
ILDLIINSCKIKDKKPSFIMSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggagttaggagcgtcaaaaagaggtaccgataaaggg
gttaggcgtttgagagaggttttgagcgcaacgcatggcgatgtgattaaaggcatgcaa
acaatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgaaaaa
aaagaattccctttgatcttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagatgcgcatgcagat
attcacacggcttatgacagcgattcaaaacatatccatggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcacagagcagagcgaaagagatgtgattaaggaattagaaatc
cctttatttagcgtgggcgcgataagagaaaacatgcaaggagtggttcaaaaaaccaaa
gaattgttaaaagcggtggatattatttaccttagcctggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaagg
caattactaggcttgcttttagaaagttttaaagaccgattaggagcacttgaagtaacc
gaatacaaccccacggtgagcaccaaacacaataacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttataatg
agttactga

DBGET integrated database retrieval system