KEGG   Helicobacter pylori B8: HPB8_203Help
Entry
HPB8_203          CDS       T01262                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpl  Helicobacter pylori B8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPB8_203 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPB8_203 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPB8_203 (trpA)
Enzymes [BR:hpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPB8_203 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
177625..178413
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIDSGVNALELGFAFSDPVADG
VIIQASHLRALKHASMAKNFQLLKKIRSYNHDIPIGLLTYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVIKSAQKHHIKQIFIASPNASDKDLEQAAIHSQGYIYTLARSGV
TGISHALENNASAIIKTLKAFSPTPALLGFGISQKEHIKNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcccaattatgaatggagttttgaaatcattaaaaccctaatt
gatagcggggtgaacgctttagaattggggtttgctttctcagaccctgtagcggatggc
gttattatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagaagctacaaccatgatattcccatagggcttttaacgtat
gcgaatctcattttttcttatggcgtggataatttttacgctcaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccacattaaacaaatctttatcgccagccctaatgcgagtgataaagat
ttagaacaagccgctatacattcgcaaggctatatctacactttagccaggagtggggtt
acagggataagccatgctctagagaacaatgcaagcgcgatcatcaaaaccttaaaagcc
tttagccctaccccagccttactgggctttggcatttctcaaaaagaacacatcaaaaac
gctaaaggcatgggcgctgatggcgtgatctgcggctcagcgttagttaaaatcatagaa
gaaaatttgaacaatgaaaacgccatgctagaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system