KEGG   Helicobacter pylori B8: HPB8_203Help
Entry
HPB8_203          CDS       T01262                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00260  Glycine, serine and threonine metabolism
hpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpl01100  Metabolic pathways
hpl01110  Biosynthesis of secondary metabolites
hpl01130  Biosynthesis of antibiotics
hpl01230  Biosynthesis of amino acids
Module
hpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPB8_203 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPB8_203 (trpA)
Enzymes [BR:hpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPB8_203 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBI65760
UniProt: D7FC53
Position
177625..178413
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIDSGVNALELGFAFSDPVADG
VIIQASHLRALKHASMAKNFQLLKKIRSYNHDIPIGLLTYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVIKSAQKHHIKQIFIASPNASDKDLEQAAIHSQGYIYTLARSGV
TGISHALENNASAIIKTLKAFSPTPALLGFGISQKEHIKNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcccaattatgaatggagttttgaaatcattaaaaccctaatt
gatagcggggtgaacgctttagaattggggtttgctttctcagaccctgtagcggatggc
gttattatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagaagctacaaccatgatattcccatagggcttttaacgtat
gcgaatctcattttttcttatggcgtggataatttttacgctcaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccacattaaacaaatctttatcgccagccctaatgcgagtgataaagat
ttagaacaagccgctatacattcgcaaggctatatctacactttagccaggagtggggtt
acagggataagccatgctctagagaacaatgcaagcgcgatcatcaaaaccttaaaagcc
tttagccctaccccagccttactgggctttggcatttctcaaaaagaacacatcaaaaac
gctaaaggcatgggcgctgatggcgtgatctgcggctcagcgttagttaaaatcatagaa
gaaaatttgaacaatgaaaacgccatgctagaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system