KEGG   Helicobacter pylori B8: HPB8_36Help
Entry
HPB8_36           CDS       T01262                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hpl  Helicobacter pylori B8
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hpl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41562..42905)
Genome map
AA seq 447 aa AA seqDB search
MKLKKTLTYQNHTYSFLSDNTHEVLENPKEILFVKTPLNEKYSPFIAEKNLAILDFNELK
NYFDFKIKIVGITGTNGKTTTASLMYSLLLDLNKKTALLGTRGFFINDERIKEKGLTTPT
LLELYSDLEEAMRLGCEYFIMEVSSHAIVQKRVAGLDFALKILTNITSDHLDFHESIENY
RDAKNSFFKDEGLKVINRDETNALFNPINAHTYALDKKAHLNVQAFSLTPSISASLCYQQ
DLRDPNLKEIALMHSPLLGRYNLYNILAGVLGVKLLTQLPLETIAPLLENFYGVKGRLEI
VHSKPLVVVDFAHTTDGMQQVFESFKNQKITALFGAGGDRDKTKRPEMGAVASYYAHKIV
LTSDNPRSENEEDIIKDILKGISNSSKVVVEKDRKKAILSALENLKDDEVLLILGKGDEN
TQIFKDKTIFFSDQEVVKSYYQHLKQG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaaaaaaaccctaacttatcaaaaccacacctattcttttttaagcgataac
acgcatgaagttttagaaaaccctaaagaaatcctttttgtcaaaacgcctttaaatgaa
aaatactctcctttcattgcagaaaaaaacctggctattttagattttaacgagcttaaa
aactactttgattttaaaattaaaattgtagggattactggcactaatggtaaaacgacc
acagcgagtttgatgtattccttgctcttagatttgaataaaaagaccgctcttttaggc
acaagggggttttttattaacgatgaacgcatcaaagaaaagggcttgaccacgcccacc
cttttagagctttatagcgatttagaagaagcgatgcgtttggggtgtgaatactttatt
atggaagtgagctcccatgcgattgtccaaaagcgcgttgccgggcttgattttgccctt
aaaatcttaactaatatcacaagcgatcatttagatttccacgaaagcatagaaaattac
agagacgctaaaaacagcttttttaaagatgagggcttgaaagtgatcaacagagatgaa
acaaacgccctttttaaccccattaacgcgcacacttacgcgctggataaaaaagctcat
ttaaacgttcaagccttttcgctcaccccctctattagcgcgtctttatgctaccaacaa
gatttaagagatcctaatctcaaagaaatcgcccttatgcattccccccttttagggcgt
tacaacctttataatatcttagcgggcgttttaggggtcaaattactcactcaattaccg
ctagaaacgattgcgccgttattagaaaacttttatggggttaaggggcgtttggaaatt
gtgcattctaaacctttagtggttgtggattttgcccacaccacagacggcatgcaacaa
gtctttgaaagctttaaaaaccaaaaaatcaccgctctttttggagcagggggcgatagg
gataaaaccaagcgccctgaaatgggagcggtagcgagctactacgcgcataaaatcgtc
ttaacttcagacaaccctagaagcgagaatgaagaagacattattaaggatattttaaaa
ggcatcagcaattcttccaaagtggttgtagaaaaagaccgaaagaaagccattttaagc
gctttagaaaatttaaaagacgatgaggtgttattgattttaggcaagggcgatgaaaac
actcagattttcaaagacaaaacgattttttttagcgaccaagaagtcgttaaaagctat
taccaacatttaaaacaaggatga

DBGET integrated database retrieval system