KEGG   Helicobacter pylori B8: HPB8_394Help
Entry
HPB8_394          CDS       T01262                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00010  Glycolysis / Gluconeogenesis
hpl00020  Citrate cycle (TCA cycle)
hpl00620  Pyruvate metabolism
hpl00640  Propanoate metabolism
hpl00650  Butanoate metabolism
hpl00680  Methane metabolism
hpl01100  Metabolic pathways
hpl01120  Microbial metabolism in diverse environments
hpl01130  Biosynthesis of antibiotics
hpl01200  Carbon metabolism
Module
hpl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB8_394 (porA)
   00020 Citrate cycle (TCA cycle)
    HPB8_394 (porA)
   00620 Pyruvate metabolism
    HPB8_394 (porA)
   00640 Propanoate metabolism
    HPB8_394 (porA)
   00650 Butanoate metabolism
    HPB8_394 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPB8_394 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPB8_394 (porA)
Enzymes [BR:hpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPB8_394 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CBI65951
UniProt: D7FCP4
Position
complement(361027..362250)
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattgcaagagatagaagtgtgggatggcaacaccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cctattgtgcagaattatggctcgtttaaggataatggctatgttgatggcgaattcgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagcggccgctgctggaggg
agagtcagcactgcgaccagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattctggctggatcagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttgcgccccttcccttatgaaagattagggcaggatttgaaaaatcttaaa
gctttagcgattttagacaagagctctccagcgggtgctatgggggcaatgtttaatgag
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system