KEGG   Helicobacter pylori B8: HPB8_395Help
Entry
HPB8_395          CDS       T01262                                 

Gene name
porD
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00010  Glycolysis / Gluconeogenesis
hpl00020  Citrate cycle (TCA cycle)
hpl00620  Pyruvate metabolism
hpl00640  Propanoate metabolism
hpl00650  Butanoate metabolism
hpl00680  Methane metabolism
hpl01100  Metabolic pathways
hpl01120  Microbial metabolism in diverse environments
hpl01130  Biosynthesis of antibiotics
hpl01200  Carbon metabolism
Module
hpl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB8_395 (porD)
   00020 Citrate cycle (TCA cycle)
    HPB8_395 (porD)
   00620 Pyruvate metabolism
    HPB8_395 (porD)
   00640 Propanoate metabolism
    HPB8_395 (porD)
   00650 Butanoate metabolism
    HPB8_395 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPB8_395 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPB8_395 (porD)
Enzymes [BR:hpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPB8_395 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CBI65952
UniProt: D7FCP5
Position
complement(362260..362652)
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggggcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacataatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaaacctgtgcataacaataatatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggtaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccccaaatcgctatggatgtttgaagagcaaattgagcccgctaccgcactcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system