KEGG   Helicobacter pylori B8: HPB8_621Help
Entry
HPB8_621          CDS       T01262                                 

Gene name
folE
Definition
GTP cyclohydrolase I FolE (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hpl  Helicobacter pylori B8
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(587152..587694)
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFESIGEDKNREGLKETPKRVQELWKFLYKGYKEDPKVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGNISLGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTTQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccagttttttgaaagtatcggcgaagataagaatagagaaggt
ctaaaagaaacgcctaaaagggttcaagaattatggaaattcttgtataaaggctacaaa
gaagatcctaaagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgaacaccatttgctcccttttttgggg
aatatcagtttaggatacattcctaaagaaaagattgtaggcattagcgcgatcgccaaa
ctcattgaaatttatagcagacgcttgcaaatccaagaaaggctgaccactcaaattgca
gaaacctttgatgaaatcatagagccaaggggcgtgattgtggtttgtgaagccaagcat
ttgtgcatgagcatgcagggggtgcaaaagcaaaatgcgatcattaaaacaagcgtgtta
agaggcctcttcaaaaaagaccctaaaaccagagctgaatttatgcaactcttaaaatct
tag

DBGET integrated database retrieval system