KEGG   Helicobacter pylori B8: HPB8_684Help
Entry
HPB8_684          CDS       T01262                                 

Gene name
pldA
Definition
outer membrane phospholipase A1 (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hpl  Helicobacter pylori B8
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hpl00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hpl00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hpl00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hpl00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658647..659714
Genome map
AA seq 355 aa AA seqDB search
MKSIWLFMIFIVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTDWFQIYNDPQSAPMRMMNFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGQPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatttggctctttatgatttttatagtttgtcagttagaaggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgcaaacaggatttgcacatc
attaaaacgcaaaacgatttgtccaatgcctggtatctccctccacaaaaagcccccaaa
gaacattcttgggtggattttgctaaaaagtatttaaacatgatggattatctaggcact
tattttctgcctttttatcatagtttcacccccatttttcaatggtaccaccccaatatc
aacccctatcaacgcaatgagtttaagttccaaatcagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctgtatttggcttatacccaaactgattggtttcaa
atttacaatgacccccaatccgctcccatgcgaatgatgaatttcatgcctgaactcatc
tatgtttatcctattaattttaaaccttttgggggtaagatagggaatttttctgaaatt
tggataggttggcaacacatttctaatggcgtggggggtgcgcaatgttaccagcctttt
aataaagaaggtaatcctgaaaaccagtttccaggacaacctgtaatcgttaaagattat
aacgggcaaaaagatgtgcgctggggggggtgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggcctaaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaaccctaatttgattgattatatggggtatggtaacgctaaa
gttgattacaggagagggcgccatcattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttgaacccttaa

DBGET integrated database retrieval system