KEGG   Helicobacter pylori B8: HPB8_684Help
Entry
HPB8_684          CDS       T01262                                 

Gene name
pldA
Definition
(GenBank) outer membrane phospholipase A1 precursor
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00564  Glycerophospholipid metabolism
hpl00565  Ether lipid metabolism
hpl00592  alpha-Linolenic acid metabolism
hpl01100  Metabolic pathways
hpl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPB8_684 (pldA)
   00565 Ether lipid metabolism
    HPB8_684 (pldA)
   00590 Arachidonic acid metabolism
    HPB8_684 (pldA)
   00591 Linoleic acid metabolism
    HPB8_684 (pldA)
   00592 alpha-Linolenic acid metabolism
    HPB8_684 (pldA)
Enzymes [BR:hpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPB8_684 (pldA)
    3.1.1.32  phospholipase A1
     HPB8_684 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: CBI66241
UniProt: D7FDI4
Position
658647..659714
Genome map
AA seq 355 aa AA seqDB search
MKSIWLFMIFIVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTDWFQIYNDPQSAPMRMMNFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGQPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatttggctctttatgatttttatagtttgtcagttagaaggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgcaaacaggatttgcacatc
attaaaacgcaaaacgatttgtccaatgcctggtatctccctccacaaaaagcccccaaa
gaacattcttgggtggattttgctaaaaagtatttaaacatgatggattatctaggcact
tattttctgcctttttatcatagtttcacccccatttttcaatggtaccaccccaatatc
aacccctatcaacgcaatgagtttaagttccaaatcagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctgtatttggcttatacccaaactgattggtttcaa
atttacaatgacccccaatccgctcccatgcgaatgatgaatttcatgcctgaactcatc
tatgtttatcctattaattttaaaccttttgggggtaagatagggaatttttctgaaatt
tggataggttggcaacacatttctaatggcgtggggggtgcgcaatgttaccagcctttt
aataaagaaggtaatcctgaaaaccagtttccaggacaacctgtaatcgttaaagattat
aacgggcaaaaagatgtgcgctggggggggtgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggcctaaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaaccctaatttgattgattatatggggtatggtaacgctaaa
gttgattacaggagagggcgccatcattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttgaacccttaa

DBGET integrated database retrieval system