KEGG   Helicobacter pylori B8: HPB8_71Help
Entry
HPB8_71           CDS       T01262                                 

Gene name
ccp
Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpl  Helicobacter pylori B8
Brite
Enzymes [BR:hpl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPB8_71 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(76396..77448)
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCTHALNDLELIKKARESQLEPMPMGKALKEYQIKKTRDVGIGTKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFGALRGKKPKIIYPELPIMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttgttgggcgtttgcttggctttttcttgcactcatgccctaaac
gatttagaattgatcaaaaaagcgagggaaagccagttagaacccatgcctatgggcaaa
gcgctcaaagaataccaaatcaaaaaaaccagagatgtgggtattggcaccaaaaacagc
gaaatcatgacctccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatttgggcttaggcggggtggat
ttagttccaagcgcggtaggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactccgtgtttaacgatgtgcagttttgggatggcagggttacgcattta
aacgaacaagcgcaagggccgatccagtcttcttttgaaatgggggctgatcccaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaagctctttagaaaagcctatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
cttattaccccaagccgttatgacgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
atcaatcttggggggacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttattttcataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaggaagcgaaaaaaattgaa
actttctttggagccttaaggggtaaaaaacctaaaataatctacccagaactccccata
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system