KEGG   Helicobacter pylori B8: HPB8_9Help
Entry
HPB8_9            CDS       T01262                                 

Gene name
res
Definition
type III restriction enzyme (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpl  Helicobacter pylori B8
Brite
Enzymes [BR:hpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HPB8_9 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9162..12071
Genome map
AA seq 969 aa AA seqDB search
MKIKFKRLDYQEQCRDQILGVFKGIDLREPENDAQRIANPVFEIGAIKDVLLENIENLRS
KQKITQGSVGIEKSLNCDILMETGTGKTFCFLECVYALHKNYHLSKFIVLVPSNAIKLGV
LKSVEITREFFKSEYSTHLESYEDVERFILASNHKCCVLVMTFSAFNSEKNTINQSCLEN
TNLFNGAKSYMQALASIRPIVIMDEPHRFLGDKTKKYLEQLNALLTLRFGATFKDDYNNL
IYALDSKKAFDCALVKSISVASVGESDECFLELKGIEKRNGYEAAINYTDLENKTQSVKV
KTHDNLGVVTQISALEDYIVEKITKTEIRFLNGFNLLLDQKEPFSHLLEGEQEVMLKEAI
KSHFEREEGLFKKGIKALCMVFISGVNSYLSENEKPAKLALLFEKLYQQKLEEVLKKPLD
ENYRAYLERTKDAILKVHGGYFAKSKKESDEAQVIALILKEKEKLLSFESDLRFIFSQWA
LQEGWDNPNVMTICKLAPSHSNITKLQQIGRGLRLAVNDKGERITKEHADFDFVNELVVI
VPQVEGDFVGAIQQEISEHSLIKQAFSAEELEKSGIVEKGRYGFLFETLESLGFGEKTGD
ENFKLTLNQNEFLEKEPELERLKDEKYLDLEKLKDFLKDRLIGNSRVRKKNERKSEKIKI
NKENFKKFETLWESLNHQARIAYAIDSESLIDEIVKNINSSFNVKSKIVSVTTHKKVETM
GNNAKTEMFERESACVWSLHEFISALSNKVKLSFKSVAKVLEKIDENKFNEIKKNEQEGL
RRLEELFLEIIYQNIKDKISYQMRETTIKNRKNDAFYDEKGEIREFLDGSLGVDKYEIKN
SSAQERCLYENFMQVDSEIEKGMIEESNDTKIIVFGKLPRVKIPIGLNQTYSPDFGYVVE
NNDKKVLLIVETKGVEHENELRDEEKCKISTAEKFFEALKKQGVNIEYKTKMKKDQLSAL
INEILNRKD
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcaaattcaaacgattggattatcaggagcaatgtcgggaccaaattttaggg
gtgtttaaggggattgatttgagggagccagaaaatgacgctcaaaggattgctaaccct
gtttttgaaataggggcgatcaaagatgttttattagaaaatattgagaatttacgatcg
aaacaaaaaataacccagggaagcgtggggattgagaagtcgttaaactgcgatatttta
atggaaacaggcactgggaagaccttttgctttttggaatgcgtttatgccttgcacaaa
aactaccatttgtcaaaatttatcgttttagtgccaagcaacgccattaaattaggggtt
ttaaagagcgttgaaatcaccagagaattttttaaaagcgagtattctacgcatttagaa
agctatgaagatgtagaaagattcattctagcgagcaaccataaatgctgcgtgttggtg
atgactttttctgcctttaatagtgagaaaaacactatcaatcaatcatgcctagaaaac
acgaatctattcaatggtgcaaaaagttacatgcaagctttagcgagtatacgccccatc
gtaatcatggacgaaccgcaccgatttttaggcgataaaacaaaaaaatatttggaacaa
ttaaacgctttactcacgctcaggtttggggcgacttttaaagatgattataataatctg
atttacgcgctagacagcaaaaaagcgtttgattgcgccctagtgaaaagcattagcgtg
gcgtctgtgggggagagtgatgagtgttttttagagcttaaagggattgaaaaaagaaat
ggatatgaagctgcaatcaactacacggatttagaaaataaaactcaaagcgtcaaagtc
aaaacgcatgataatttaggggtggtaactcaaatcagcgctttagaagattacattgta
gaaaaaatcactaaaactgagattcgttttctcaatggctttaatttgttactggatcaa
aaagagcctttttctcatcttttagagggcgaacaagaagtgatgctgaaagaagcgata
aaaagccattttgaaagagaagaagggctttttaaaaaggggattaaagccttgtgcatg
gtgtttattagcggggtgaatagctatttaagcgaaaatgaaaagccggctaaattggcc
cttttatttgaaaaactctaccaacaaaagcttgaagaagtcttaaaaaagcctttagat
gaaaattatagagcgtatttagagcgcaccaaagacgctattttaaaagtgcatggaggg
tattttgctaaaagcaagaaagagagcgatgaagcccaagtgatcgcactcattttaaaa
gaaaaagaaaaattgctgagttttgaatccgatctcaggtttattttttcgcaatgggcg
ttgcaagaggggtgggataaccctaacgtgatgacgatttgcaaattagcccctagccat
tccaatatcactaaattgcaacaaatcggtagggggttaaggctcgctgtgaatgataag
ggcgaacgcatcactaaagagcatgctgattttgattttgtcaatgaattggtggtgatc
gtgccgcaagttgagggggattttgtgggagcgatccagcaagagataagcgaacatagc
ttgattaaacaagcatttagcgcagaagagttagaaaaaagcggcattgttgaaaaaggg
cgttacgggtttttatttgaaacattagagagtttgggttttggagaaaaaacaggtgat
gaaaactttaaactcactctcaaccaaaacgaatttttagaaaaagagccggaactagaa
agattaaaagatgaaaaatacctagatcttgaaaaactaaaagattttttaaaagatcgc
ttgattggtaattctagagtgagaaagaaaaacgagcgaaagagtgaaaaaatcaaaatc
aataaagaaaattttaaaaaatttgaaaccttatgggagagcttgaatcatcaagcccgg
atcgcttatgccattgatagcgagagtttgattgatgagattgtcaaaaatattaattct
tcttttaatgtcaagtcaaaaatcgtttcggttacgactcataaaaaagtagaaactatg
ggaaataacgccaaaacagagatgtttgagcgagaaagcgcatgcgtgtggagtttgcat
gaatttatcagcgccttgtctaataaggtgaaattgagttttaaaagcgtggctaaagtg
ttggaaaaaattgatgaaaacaagtttaatgaaattaaaaaaaacgaacaagagggctta
aggcggttagaagagctgtttttggaaattatttatcaaaatattaaagataaaatctcc
tatcaaatgcgcgaaacgacgattaaaaacagaaaaaacgatgcgttttatgatgaaaaa
ggagaaattagagaatttttagacgggagtttgggggtggataaatatgaaattaaaaat
tcaagcgctcaagaaagatgcctgtatgaaaatttcatgcaagtggatagcgagattgaa
aaaggcatgattgaagaatctaacgacactaaaatcattgtttttggcaagctccctagg
gttaaaatcccgatagggttaaatcaaacttatagccctgattttgggtatgtggttgaa
aacaacgataaaaaagtgttgttaattgtagaaactaagggggttgaacatgaaaatgaa
ttgcgcgatgaagaaaagtgcaaaatttcaaccgctgagaaattttttgaagctttaaaa
aagcaaggcgtgaatattgaatacaaaaccaaaatgaaaaaagatcaattaagcgcgttg
attaatgaaattttaaatcgtaaagattag

DBGET integrated database retrieval system