KEGG   Helicobacter pylori SJM180: HPSJM_00555Help
Entry
HPSJM_00555       CDS       T01323                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSJM_00555
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSJM_00555
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSJM_00555
Enzymes [BR:hpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSJM_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(102834..104294)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKERKIDFIEAVLNPNAPKGGLYTLEHFETLEWQDCLGMSYSELVEHVFELL
NLEIPKNLLASALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNSALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTKRSLKQTYSPAMDILKSSNVERVLFSLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEDCLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFEKGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgctctttgaaagaaagaaagattgattttattgaagcggta
ttaaaccccaacgcccccaaaggcgggctttacactttagagcattttgaaacgctagaa
tggcaagattgtttgggcatgagctatagcgaattagtagagcatgtgtttgagctttta
aatttagaaatccctaaaaatttactagcaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaacccagcccctatttttgcgctcaatgaaaggctttttgtccaagaactc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtggggaaaaatgaaaaatatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttggtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacagcgctttaaaagcgcgccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatctggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgcattaggggcgttttatgccaaaaaaatgggcttgaatatc
gctaaaatcaaggtcgtaaccaacagcaacgatgttttaagagagtttatagagacaggc
cgttacgatttgactaagcgctctttaaagcaaacctactcgccggctatggatatttta
aaaagctccaatgtggaaagagtgctttttagcctttttgggtttgagcgaacgctggaa
ttgatgcaagctttagaagaagagaaattttatgccttaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagattgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaactaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaatactccagatagtcagcgccttgatgatttatttgag
aaaggaatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system