KEGG   Helicobacter pylori SJM180: HPSJM_01055Help
Entry
HPSJM_01055       CDS       T01323                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00010  Glycolysis / Gluconeogenesis
hpm00051  Fructose and mannose metabolism
hpm01100  Metabolic pathways
hpm01110  Biosynthesis of secondary metabolites
hpm01120  Microbial metabolism in diverse environments
hpm01130  Biosynthesis of antibiotics
hpm01200  Carbon metabolism
hpm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSJM_01055 (tpiA)
   00051 Fructose and mannose metabolism
    HPSJM_01055 (tpiA)
   00562 Inositol phosphate metabolism
    HPSJM_01055 (tpiA)
Enzymes [BR:hpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPSJM_01055 (tpiA)
Exosome [BR:hpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPSJM_01055 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPSJM_01055 (tpiA)
  Exosomal proteins of melanoma cells
   HPSJM_01055 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADO01810
UniProt: E1Q216
Structure
PDB: 

Jmol
Position
202365..203069
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDMVFVFPDFLGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRTLLKESPSFLKEKFDFFKDKNFKIVY
CIGEELTTREKGFKAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNIQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattggaaaaaactttaaaaccgcagcattttgacatggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ttaaaaatccacacgcttttaatagggcatagcgagaggcgaacgcttttaaaggaaagc
cctagttttttgaaagaaaagtttgatttttttaaagataaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagatatttatctcacgcatggt
tttttaaaacaaatcttaaatcaaaaaacgcccttattgtatggggggagcgtgaatata
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgattgggagcgca
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system