KEGG   Helicobacter pylori SJM180: HPSJM_01165Help
Entry
HPSJM_01165       CDS       T01323                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSJM_01165
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPSJM_01165
Enzymes [BR:hpm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPSJM_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(221237..222388)
Genome map
AA seq 383 aa AA seqDB search
MNALEITQKLISYPTITPKECGIFEYIKSLFPAFKTLECRENGVKNLFLYRIFNSPKEHA
EEKHAEEDTKPLHFCFAGHIDVVPPGNNWQSDPFKPIIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFMLSILLTSDEEGPGIFGTKLMLEKLKEKDLLPHMAIVAEPTCEKVLGDS
IKIGRRGSINGKLILKGIQGHVAYPQKCQNPIDTLASVLPLISGVHLDNGDECFDPSKLV
ITNLHAGLGANNVTPGSVEITFNARHSLKTTQESLKEYLEKVLKDLPYTLELESSSSPFI
TASHSKLTSVLQENILKTCRTTPLLNTKGGTSDARFFSTYGIEVVEFGVINDRIHAVDER
VSLKELELLEKVFLGVLEDLNEK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttagaaatcacccaaaaactcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctgcttttaaaaccctagaatgtagg
gaaaatggcgtgaaaaacctttttttataccgcatttttaactctcccaaagagcatgca
gaagaaaagcatgcagaagaggatactaagcccttgcatttttgctttgcagggcatatt
gatgtcgtgcctcctggtaataactggcaaagcgatccctttaaacccattattaaagaa
gggtttttatacggccgtggggcgcaagacatgaaaggaggcgttggggcatttttgagc
gcgagtttaaattttaaccctaaaacccctttcatgctttctattttactcacgagcgat
gaagaagggccagggatttttggcaccaaactcatgctagaaaaactcaaagaaaaggat
ttgctgccccatatggcgattgtggctgaacccacttgcgaaaaagtcttaggcgatagc
atcaaaattggccgaagaggctccattaatggcaaactcattttaaaaggcattcaaggg
catgtggcttacccgcaaaaatgccaaaaccctattgatacgctcgcttcggttttgcct
ctcatttcaggagttcatttagacaatggcgatgagtgttttgacccttcaaaattagtc
atcaccaacttgcatgcagggttaggggctaataatgtgacaccagggagcgtagaaatt
acctttaatgcgcgccattctttaaaaaccacccaagagagtttgaaagaatatttagaa
aaggttttgaaagatttgccttatactttagaattagaatcaagcagttcgcctttcatc
acggcttctcattcaaagcttaccagcgttttacaagaaaatattttaaaaacatgccgc
accaccccccttttaaacaccaaaggcggcacgagcgatgcgcggttttttagcacttat
ggtatagaagtggtggaatttggcgtgattaatgacaggatccatgccgttgatgaaaga
gtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagaggatttg
aacgagaaatga

DBGET integrated database retrieval system