KEGG   Helicobacter pylori SJM180: HPSJM_01280Help
Entry
HPSJM_01280       CDS       T01323                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpm  Helicobacter pylori SJM180
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243383..244180
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLGGIFFSNNAGDVKLLTETNQKILALNTNQQN
SAKLNAIFNEIPADYAIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttgtagtgagt
aaggatggtaatttagtcatagggcttggcggtatcttttttagcaataatgccggagat
gtgaaattgcttacagaaaccaatcaaaaaatcctagcccttaacaccaaccagcaaaat
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcagccaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataagatctctatccttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaagggtgtacctttctta
taccattataaggcatga

DBGET integrated database retrieval system