KEGG   Helicobacter pylori SJM180: HPSJM_01495Help
Entry
HPSJM_01495       CDS       T01323                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpm01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hpm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285007..285582
Genome map
AA seq 191 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDYVFVTPDEVLETLLK
ENTRTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIIHQDFFISHYQLLESLVQGS
DGVVLDEELLKEDLKGMVEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLENSPHSYNQKK
NSLFRLNFKLI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaggattatgtttttgtaacccctgatgaggttttagaaacgcttttgaaa
gaaaacacccgcaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgata
atccatcaggattttttcatcagccactaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagacgaagagcttttaaaagaggatttaaagggcatggtagaattc
gcttggcgtttgggcttgagcgtgtttgtagaaacccacaagccagactacactcattta
aaagatttaggggttttaggcgtgctagaaaatagcccccattcttataatcaaaaaaaa
aatagtctttttagattgaattttaagctaatttag

DBGET integrated database retrieval system