KEGG   Helicobacter pylori SJM180: HPSJM_01495Help
Entry
HPSJM_01495       CDS       T01323                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpm01100  Metabolic pathways
hpm01110  Biosynthesis of secondary metabolites
hpm01130  Biosynthesis of antibiotics
hpm01230  Biosynthesis of amino acids
Module
hpm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSJM_01495
Enzymes [BR:hpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPSJM_01495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ADO01895
UniProt: E1PXZ6
Position
285007..285582
Genome map
AA seq 191 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDYVFVTPDEVLETLLK
ENTRTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIIHQDFFISHYQLLESLVQGS
DGVVLDEELLKEDLKGMVEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLENSPHSYNQKK
NSLFRLNFKLI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaggattatgtttttgtaacccctgatgaggttttagaaacgcttttgaaa
gaaaacacccgcaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgata
atccatcaggattttttcatcagccactaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagacgaagagcttttaaaagaggatttaaagggcatggtagaattc
gcttggcgtttgggcttgagcgtgtttgtagaaacccacaagccagactacactcattta
aaagatttaggggttttaggcgtgctagaaaatagcccccattcttataatcaaaaaaaa
aatagtctttttagattgaattttaagctaatttag

DBGET integrated database retrieval system