KEGG   Helicobacter pylori SJM180: HPSJM_03290Help
Entry
HPSJM_03290       CDS       T01323                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPSJM_03290
   00052 Galactose metabolism
    HPSJM_03290
   00500 Starch and sucrose metabolism
    HPSJM_03290
   00520 Amino sugar and nucleotide sugar metabolism
    HPSJM_03290
Enzymes [BR:hpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPSJM_03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660978..661799
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSKTKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctacccattgtggataaacctttaatccaatacgctgta
gaagaagcgatggaagcgggctgtgaagtgatggcgatcgttacaggaaggaataaacga
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggagaagcccttataggc
aatgagccttttgcagtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgttaaagcaaatgacttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgatcagaggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctggccgtgatagggcgctacattttaaccccggatatttttgaaattttaagcaagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacgcatcatcgcttaccaattcaaaggtaagcgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system