KEGG   Helicobacter pylori SJM180: HPSJM_03505Help
Entry
HPSJM_03505       CDS       T01323                                 

Definition
succinyl-CoA-transferase subunit A
Orthology
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hpm00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hpm00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hpm00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710750..711448
Genome map
AA seq 232 aa AA seqDB search
MNKVITDLDKALSGLKDGDTILVGGFGLCGIPEYAINYIYKKGIKDLIVVSNNCGVDDFG
LGILLEKKQIKKIIASYVGENKIFESQMLNGEIEVVLTPQGTLAENLRAGGAGIPAYYTP
TGVGTLIAQGKESREFNGKEYILERAITGDYGLIKAYKSDTLGNLVFRKTARNFNPLCAM
ASKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEKFEKRIEKITTRSTK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttataaccgatttagacaaagcgttgagcgggttaaaagatggggatact
attttagtgggcggttttgggctgtgcgggatacccgaatacgccattaattacatttat
aagaaaggcatcaaagatttgattgtcgtgagcaataattgcggcgttgatgactttggg
ttgggtattcttttggaaaaaaagcagattaaaaagattatcgcttcgtatgtgggggag
aataagatttttgaatcgcaaatgctgaatggagaaattgaagtcgttttgacaccgcaa
ggcacgctggctgaaaacttgcgcgctggaggggctgggatacccgcttattacacccca
acaggagttgggactttgatcgctcaaggcaaggaatcaagggagtttaacggcaaggag
tatattttagaaagagccataacgggcgattacgggcttatcaaagcctataaaagcgac
acccttgggaatttggtgtttagaaaaacggcccgaaatttcaaccccttgtgtgcgatg
gcgtcaaaaatatgcgtcgctgaagtggaagaaattgtcccggccggggaattagaccca
gatgaaatacacttgccaggaatctatgtgcaacacatctataagggcgagaaatttgaa
aaacggatagaaaaaatcacgacaaggagcacgaaatga

DBGET integrated database retrieval system