KEGG   Helicobacter pylori SJM180: HPSJM_03505Help
Entry
HPSJM_03505       CDS       T01323                                 

Definition
succinyl-CoA-transferase subunit A
Orthology
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HPSJM_03505
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HPSJM_03505
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSJM_03505
Enzymes [BR:hpm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     HPSJM_03505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710750..711448
Genome map
AA seq 232 aa AA seqDB search
MNKVITDLDKALSGLKDGDTILVGGFGLCGIPEYAINYIYKKGIKDLIVVSNNCGVDDFG
LGILLEKKQIKKIIASYVGENKIFESQMLNGEIEVVLTPQGTLAENLRAGGAGIPAYYTP
TGVGTLIAQGKESREFNGKEYILERAITGDYGLIKAYKSDTLGNLVFRKTARNFNPLCAM
ASKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEKFEKRIEKITTRSTK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttataaccgatttagacaaagcgttgagcgggttaaaagatggggatact
attttagtgggcggttttgggctgtgcgggatacccgaatacgccattaattacatttat
aagaaaggcatcaaagatttgattgtcgtgagcaataattgcggcgttgatgactttggg
ttgggtattcttttggaaaaaaagcagattaaaaagattatcgcttcgtatgtgggggag
aataagatttttgaatcgcaaatgctgaatggagaaattgaagtcgttttgacaccgcaa
ggcacgctggctgaaaacttgcgcgctggaggggctgggatacccgcttattacacccca
acaggagttgggactttgatcgctcaaggcaaggaatcaagggagtttaacggcaaggag
tatattttagaaagagccataacgggcgattacgggcttatcaaagcctataaaagcgac
acccttgggaatttggtgtttagaaaaacggcccgaaatttcaaccccttgtgtgcgatg
gcgtcaaaaatatgcgtcgctgaagtggaagaaattgtcccggccggggaattagaccca
gatgaaatacacttgccaggaatctatgtgcaacacatctataagggcgagaaatttgaa
aaacggatagaaaaaatcacgacaaggagcacgaaatga

DBGET integrated database retrieval system