KEGG   Helicobacter pylori SJM180: HPSJM_04710Help
Entry
HPSJM_04710       CDS       T01323                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hpm  Helicobacter pylori SJM180
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
958419..959000
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CASCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIGEDIKEIIFAFPPTLANDSLMLYIEDKLQHLHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaaccactttttaaacttagtggattgtttagaaaaa
atccccaatgtgggtaaaaagtccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgctaaaaatcacgcacgctttagagaacgcgctagaaaaccttaaaaca
tgcgcatcttgtaacgcgctcagcgagagcgaggtttgtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaagat
ttaaaggactttttagggcgctattatgtgttaaactctatagaagaagtggattttaac
gccctagaaaaacgcctgattggagaagacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctttatattgaagataaattacaacacctccatctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactcc
gtttcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system