KEGG   Helicobacter pylori SJM180: HPSJM_05445Help
Entry
HPSJM_05445       CDS       T01323                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00010  Glycolysis / Gluconeogenesis
hpm00052  Galactose metabolism
hpm00500  Starch and sucrose metabolism
hpm00520  Amino sugar and nucleotide sugar metabolism
hpm00521  Streptomycin biosynthesis
hpm01100  Metabolic pathways
hpm01110  Biosynthesis of secondary metabolites
hpm01120  Microbial metabolism in diverse environments
hpm01130  Biosynthesis of antibiotics
hpm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSJM_05445 (glk)
   00052 Galactose metabolism
    HPSJM_05445 (glk)
   00500 Starch and sucrose metabolism
    HPSJM_05445 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPSJM_05445 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSJM_05445 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPSJM_05445 (glk)
Enzymes [BR:hpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPSJM_05445 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADO02655
UniProt: E1Q0G4
Position
1104846..1105856
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECVEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggtttggaagtcgccccacgacagattgaatgcgttgaagtcttgaggtgcgaagat
tttgagagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgacgaacaaccattggactttttctattgaaacgacacggcaatgtttgaatttaaaa
aaactgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggcccaaataggcgggattaagtgcgaaatcaacgcccctaaagcgatttta
gggccaggaacggggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggcgaaggagggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatatgcccgctctaaattcaatcatgtgagtgcagaaaggtttttaagcggt
agcggcctagtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgatgaaaaaaactcccggactt
gatggggcaggcattgcgctagagaattatttactgcatgataaaatttag

DBGET integrated database retrieval system