KEGG   Helicobacter pylori SJM180: HPSJM_05490Help
Entry
HPSJM_05490       CDS       T01323                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00010  Glycolysis / Gluconeogenesis
hpm00020  Citrate cycle (TCA cycle)
hpm00620  Pyruvate metabolism
hpm00640  Propanoate metabolism
hpm00650  Butanoate metabolism
hpm00680  Methane metabolism
hpm01100  Metabolic pathways
hpm01120  Microbial metabolism in diverse environments
hpm01130  Biosynthesis of antibiotics
hpm01200  Carbon metabolism
Module
hpm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSJM_05490 (porA)
   00020 Citrate cycle (TCA cycle)
    HPSJM_05490 (porA)
   00620 Pyruvate metabolism
    HPSJM_05490 (porA)
   00640 Propanoate metabolism
    HPSJM_05490 (porA)
   00650 Butanoate metabolism
    HPSJM_05490 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPSJM_05490 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSJM_05490 (porA)
Enzymes [BR:hpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSJM_05490 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADO02664
UniProt: E1Q0H3
Position
1113007..1114230
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFKIAEHQKVRVPTIINQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtatcgaattgcaagagatagaagtgtgggatggcaacaccgctagctct
aacgctttaagacaggcccaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattatggctcgtttaaggataatggctatgttgatggcgaattcgtt
ttagtggaatctgagcatgccgctatgagcgcatgcgtgggagctgctgcagctggagga
agggtcagcactgcgaccagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctattgttttgaatttagtcaatcgcgctctagcagcccct
ttgaatatccatggcgatcattctgatatgtatttgagtagggattcaggctggatcagt
ttatgcacatgcaaccctcaagaagcttatgatttcactttaatggcgtttaaaatcgca
gagcatcaaaaggtgcgcgtgcctactattatcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttaagcgatgcagtggcttatcaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatttttgcgttaggcactacttatgaa
tccgccatcgtagcagccaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttgcgccccttcccttatgaaagattggggcaggatttgaaaaaccttaaa
gctttagcgattttagacaagagctctccagcgggtgctatgggggcgatgtttaatgag
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgagatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system