KEGG   Helicobacter pylori SJM180: HPSJM_06150Help
Entry
HPSJM_06150       CDS       T01323                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSJM_06150
Enzymes [BR:hpm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPSJM_06150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1249043..1250185
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKNALQKIGPEKIAQNHMHQKGVSFVFEIQHLPLSAALILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQ
IMAILNLTPDSFYEKSRFSSKKALEEIYQLLEKSITLIDIGAASSRPESEIIDPKTEQDR
LKEILLEIKSQKLYQCAQFSIDTYHATTAQMALEHCFSILNDVSGFNSAAMLEVARDYKP
TCVLMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRA
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaaacgctctgcaaaaaataggccca
gaaaagatcgcacaaaatcatatgcaccaaaaaggcgttagctttgtttttgaaatccaa
cacctgcccttaagcgctgcgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagccaaagagcctttttatgatggggtgctgatt
gtgagcgctaagcaattagaacgccttattgttaagtgccattcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccatctcaaagctaaaaagcctaacgctcctcag
atcatggcaatcttgaatctcacgccggatagtttctatgaaaagagccgttttagtagc
aaaaaagcgcttgaagaaatctatcaattgctagaaaaaagtattacgctcattgatata
ggcgcagccagttcaaggccagagagtgaaatcattgatccaaaaacagagcaagatcgc
ttaaaagaaattttattagaaatcaaatcccaaaaactctatcaatgcgctcaattcagc
atagacacctaccatgccacaacggcccaaatggctttggagcattgtttttctatcctt
aatgatgtgagcggttttaatagcgctgcaatgctagaagtcgcacgagattacaagccc
acttgcgttttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaattagaggttttagaaaaa
tacgcattacaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaaaaaacccttattggtg
ggagcgagccgtaaaaacacaatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gctggcactttgagtttgcatttaatggcgttgcaaaatggagcgagtattttaagagcg
catgacattgatgagcatatagatttaatcaaagtgtttaagagtttggaagaaacggat
tga

DBGET integrated database retrieval system