KEGG   Helicobacter pylori SJM180: HPSJM_06375Help
Entry
HPSJM_06375       CDS       T01323                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSJM_06375
   00030 Pentose phosphate pathway
    HPSJM_06375
   00051 Fructose and mannose metabolism
    HPSJM_06375
   00052 Galactose metabolism
    HPSJM_06375
   00500 Starch and sucrose metabolism
    HPSJM_06375
   00520 Amino sugar and nucleotide sugar metabolism
    HPSJM_06375
  Nucleotide metabolism
   00230 Purine metabolism
    HPSJM_06375
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSJM_06375
Enzymes [BR:hpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPSJM_06375
    5.4.2.8  phosphomannomutase
     HPSJM_06375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1293901..1295280
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPITLDEKSAFSIGVELGKIMRECDKSVFVGHDARTHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIKCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPEKANALEAYQRYLIKDFQHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAILIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNAINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
IIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLGILEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccatcactttagat
gaaaagagcgcttttagtattggcgtggagttggggaaaatcatgcgagaatgcgataaa
agcgtgtttgtagggcatgatgcgagaacgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcagcctttaatgaaatcaatggcattaaatgccctaattctatcatgatt
actggatctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccagagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttcagcatttgaaaaaccttaaatacaaaatcgcattggattttggtaat
ggcgtgggggcgttaggtttagagccgattttaaaggctttaaacattgattttagcagt
ctttatagcgatcctgatgggaatttccctaaccaccatccagaccctagcgaagcaaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctattttaataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggaatcaccccctttgtgataggc
gaagtcaaatgctctcaagtgatgtataacgcaatcaatacttttggtaagactctcatg
tataaaaccgggcatagcaatttaaaaatcaagctcaaagaaaccaacgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tacgcatgcttaagggctttagaattattgcttgaacaaagtccaagcgatttggaaaac
attattaaaaacctcccctattcctacaccacacctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcacaacttacaagaagcgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaag
gatgaaacaacagcgttagaatataaaagggcgttgcttgggatattagaaaaactttaa

DBGET integrated database retrieval system