KEGG   Helicobacter pylori SJM180: HPSJM_06410Help
Entry
HPSJM_06410       CDS       T01323                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSJM_06410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSJM_06410
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSJM_06410
Enzymes [BR:hpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSJM_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1297891..1299066)
Genome map
AA seq 391 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQEEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGEKDIKRQEMNVFRMRLLGAEVREVNSGSTTLKDAVNEALRDWASSYK
NTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKESKRAVYESASDTEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCAQESIIVVNLSGRGDKDLSTVYNALKEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcggagttgttagtg
cctgcattaagagagttagaacaggcgtttgatgcatgtttgaaagatgaaaaattccaa
gaagaatatttccatcttttaaaagattttgtgggacgtcctagccctttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatttaaaacgagaagatttaatccat
ggcggggcgcacaagaccaatcaggctctagggcaagcccttttagcaaaaaaaatgggt
aaaacaaggatcattgctgaaacgggcgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtaatttttatgggagaaaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtgagagaggttaattcaggg
agcacgacgcttaaagacgctgtgaatgaagccttaagagattgggcgagcagttacaag
aacacgcactatttgctaggcacagccgccgggccgcacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgtgatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcgtttttaaacgataaagaagtgaaactcataggcgtagagccagccggtttagggcta
gaaaccaataagcatggggcgactttgaataaagggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccatagcattagcgcc
gggcttgattatccaggggtggggccagaacacagctatttgaaagagagtaagcgcgcg
gtttatgaaagcgcaagcgatactgaagcgctagaggccttcagtttgttgtgtcaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgctttaaaactcgct
caaaaatgcgcacaagaaagcattattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaggaggtttaa

DBGET integrated database retrieval system