KEGG   Helicobacter pylori SJM180: HPSJM_07620Help
Entry
HPSJM_07620       CDS       T01323                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hpm  Helicobacter pylori SJM180
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hpm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1533860..1535203
Genome map
AA seq 447 aa AA seqDB search
MKLKKTLTYQNHTYSFLSDNTNEVLENPKEILFVKTPLNEKYSPLIAEKNLAILDSNELK
NYFDFKIKIVGITGTNGKTTTASLMYSLLLDLNKKTALLGTRGFFINDERIKEKGLTTPT
LLELYGDLEEAIRLGCEYFIMEVSSHAIIQKRIAGLDFALKILTNITSDHLDFHQNIENY
RDTKNSFFKDEGLKVINRDETNALFNPINTHTYALDKRAHLNVQAFSLNPSISASLCYQQ
DLRDPNLKEIALIHSPLLGRYNLYNILAGVLGVKLLTQLPLEAIAPLLENFYGVKGRLEI
VHSKPLVVVDFAHTTDGMQQVFESFKNQKITALFGAGGDRDKTKRPKMGAIASCYAHQII
LTSDNPRSENEEDIIKDILKGINDSSKVIIEKDRKKAILNALENLKDDEVLLILGKGDEN
IQIFKDKTIFFSDQEVVKDYYLNLKQG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaaaaaaaccctgacttatcaaaaccacacctattcttttttaagcgataac
acgaatgaagttttagaaaaccccaaagaaatcctttttgtcaaaacgcctttaaatgaa
aaatactctcctttaattgcagaaaaaaacctggctattttagattctaacgagcttaaa
aactactttgattttaagattaaaattgtagggattactggcactaatggtaaaacgacc
acagcgagtttgatgtattccttgctcttagatttgaataaaaagaccgctcttttaggc
acaagagggttttttattaacgatgaacgcatcaaagaaaagggtttgaccacgcccact
cttttagagctttatggcgatttagaagaagcgattcgtttggggtgtgaatactttatt
atggaagtgagctcccatgcgattatccaaaagcgcatcgccgggcttgattttgctctt
aaaatcttaaccaatatcacaagcgatcatttagatttccatcaaaatatagaaaattac
agggacactaaaaacagcttttttaaagatgagggcttgaaagtcatcaacagagatgaa
acaaacgccctttttaaccccattaacacgcacacttacgcgctggataaaagagcgcat
ttaaacgttcaagccttttcgctcaacccctccattagtgcatctttatgctaccaacaa
gatttaagagatcccaatcttaaagaaatcgctctcatccattccccccttttagggcgt
tacaacctttataatatcttagcgggcgttttaggggttaaattactcactcaattaccg
ctagaagcgattgcgccgttattagaaaacttttatggggtgaaggggcgtttggaaatt
gtgcattccaaacctttagtggtcgtggattttgcccacacaacagacggcatgcaacaa
gtttttgaaagctttaaaaatcaaaaaatcaccgctctttttggggcagggggcgatagg
gataaaaccaagcgccctaaaatgggagcgatagcgagttgttacgcgcatcaaatcatc
ttaacttcagacaaccccagaagcgaaaacgaagaagacatcattaaggatattttaaaa
ggcatcaacgattcttctaaagtcattatagaaaaagaccgaaaaaaagccattttaaac
gctttagaaaatttaaaagacgatgaggtgttgttgattttaggcaagggcgatgaaaac
attcaaatctttaaagacaaaacgattttttttagcgaccaagaagtcgttaaagattat
tatctcaatttaaaacaaggataa

DBGET integrated database retrieval system