KEGG   Helicobacter pylori India7: HPIN_00545Help
Entry
HPIN_00545        CDS       T01918                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpn  Helicobacter pylori India7
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPIN_00545
Enzymes [BR:hpn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPIN_00545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112224..112862
Genome map
AA seq 212 aa AA seqDB search
MINMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEVTIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctcaaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttca
gcgcgcattggcgcaaatcaatttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaaaatagattaccgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagtttggcgtattccttgcgccacaaccgattgctccctaga
gattatttagggtatcgttctttgggcgaagaagtaacgatttttaaccccaaagactat
gacagttggcaagaaagagcggatacagaaattttacgccaattacaagagagcaaaaaa
tattttgttttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactaggcgatttgatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system