KEGG   Helicobacter pylori India7: HPIN_00945Help
Entry
HPIN_00945        CDS       T01918                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hpn  Helicobacter pylori India7
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPIN_00945
Enzymes [BR:hpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HPIN_00945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187039..188139
Genome map
AA seq 366 aa AA seqDB search
MIVLGSTGSIGKNALKIAKKFKVEIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNSL
EPLGAEVFVGLEGIDAMIEECVSNLVINAIVGVAGLKASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLEFIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSVIA
HLASADMQLPISYAINPKLASLSASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQALESYAKMSFKLSNLDEVLALDKEVRE
RFKNYR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgattgttttaggaagcactggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
ttcaaggtagaaatagaagccttgagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtagcgattttagatcctaacgatttgaatagttta
gagcctttgggcgcagaagtgtttgtagggctagagggcattgatgcgatgatagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggcaggattgaaagcgagcttt
aaaagcttacaaactaacaaaaaactggccctagcgaataaagagagcttagtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgacagcgagcattttggtttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagcgcgagtgggggg
gcttttagggacacgcctttagaatttattcctattcaaaacgcgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaaattttagaaacttattggctttttggcgcgtctttaaagattgatgcgttg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagacaactctgtcatcgcg
catttagcgagcgcggacatgcaattacccataagctacgccattaaccctaaattagct
tctttgagcgcgtctatcaagccactagatttatacgctttgagtgcgattaaatttgaa
cccattagcatggagcgctatactttgtggcgttataaagacttgttgctagaaaaccca
aagcttggcgtggtgctgaacgcgagcaatgaagtggcgatggagaagtttttaaatcaa
gagatcgcttttggtggtcttatcaaaaccatttctcaagccttagaatcatacgctaaa
atgtccttcaagctctctaatttagatgaagtgctggcgttagataaggaagttagggag
cgttttaaaaattataggtag

DBGET integrated database retrieval system