KEGG   Helicobacter pylori India7: HPIN_01875Help
Entry
HPIN_01875        CDS       T01918                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00010  Glycolysis / Gluconeogenesis
hpn00620  Pyruvate metabolism
hpn00640  Propanoate metabolism
hpn00680  Methane metabolism
hpn01100  Metabolic pathways
hpn01110  Biosynthesis of secondary metabolites
hpn01120  Microbial metabolism in diverse environments
hpn01130  Biosynthesis of antibiotics
hpn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPIN_01875
   00620 Pyruvate metabolism
    HPIN_01875
   00640 Propanoate metabolism
    HPIN_01875
  Energy metabolism
   00680 Methane metabolism
    HPIN_01875
Enzymes [BR:hpn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPIN_01875
Lipid biosynthesis proteins [BR:hpn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPIN_01875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADU79627
UniProt: E8QF52
Position
complement(368548..370536)
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKVFNPNKAFAKQARIKNMCEYKDLVHEANEDYEHFWGELATQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDTQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLDSLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRTSCATLPLPGIHAEVLNEDGTKTKSGEQGFLCITKPWPSMI
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSIE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIVQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacgatgatttagagttcgctaaaaaagtctttaaccctaacaaagcgttt
gccaagcaagccaggattaaaaacatgtgtgaatataaagatttagtgcatgaagccaat
gaagattatgaacatttttggggcgagttagccacgcaaaaactcacatggtttaagccc
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaaa
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaagaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacctacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
gtcattatctatatgcctatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttgagagatagg
atcaacgacactcaagccaaattagttatcacagcagatgggacttttaggaaaggcaaa
ccctatatgcttaagccagcccttgacaaggctctagaaaataatgcctgccctagtgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttattcttgctctatacaagcggatcaaccgggaaacctaaaggcgtt
caacacagcagtgcggggtatttgctatgggcacaaatgacgatggagtgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggttggattacagggcacact
tatgtggtttatgggcctttagcttgtggggcgacgactttgatactagaaggcacgatg
tcttatccggattatgggagatggtggagaatgatagaagaataccgcgtggataaattc
tacacttcccccaccgctataagaatgctgcatgctaaaggcgaaaacgaacccttaaag
tataatttagactcactcaaggttttaggaacggtgggagagcccattaaccctacggca
tggaaatggttttatgaaaaaatcggcaattcaaaatgcagtatcgtggatacttggtgg
cagacagaaacaggcgggcatatcatcagccctttaccaggagctacgcctataaggact
agttgcgcgactttacctttgcctggcatccatgcagaagttttaaacgaagacggcacc
aaaacaaagtccggagaacaagggtttttatgcatcactaagccatggccttctatgata
agaaacatttggggcgatgaaaaacgatacattgatagctatttttctcagatcaagttg
aatggggaatatgtctatctctctggagatggcgctatcgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagtgggcataggatcggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggttgaatgcgcggtagtgggtatc
cctgatacgattaaaggagagggcttgtttgcgtttgtggtgctgtgcgatggggctaaa
tgcaatcttggcgagagtttagaattgctaaaagaaatgaatcatatcttatccattgag
attggaaagatcgctaaattagacaatgtcatgtatgtgccaggtttgcctaaaaccagg
agcgggaaaatcatgagaaggcttttaaaatctatcgccaaaaaagagcccatcactcaa
gatttaagcacgctagaagatgtgaatgtggtcaaagaaataatgagtatcgttcaaatg
gaagagtga

DBGET integrated database retrieval system