KEGG   Helicobacter pylori India7: HPIN_01920Help
Entry
HPIN_01920        CDS       T01918                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpn  Helicobacter pylori India7
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPIN_01920
Enzymes [BR:hpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPIN_01920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379983..380474
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
IYINPPFGYTNQPNFYNATIILKTSLSLHHFFALVFYIERRFGRKRKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSGRDSVLVPLILQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactaaccgctttttccccagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaattgggaaaatcttttcttcgccc
atttatatcaatccgccttttggttacactaatcaacccaacttttataacgctacgatt
atccttaaaacatctttaagtttgcaccatttttttgctctggttttttatatagaaagg
cgttttgggcgcaaaaggaagcgcgattttaaagacgctccaagaactttggatattgat
attatcgctttcaaccaagtcattttaaggcagaatgatttgactttacctcatcctaaa
tggagtggaagggattcggtgttggtgccgttaattttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system