KEGG   Helicobacter pylori India7: HPIN_05380Help
Entry
HPIN_05380        CDS       T01918                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hpn  Helicobacter pylori India7
Brite
Enzymes [BR:hpn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HPIN_05380 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101629..1102258
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEIHKRFHLHPKVRKAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYLEARLRLKTL
GLDNVHVKFADGNKGWDQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCSFVPIVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtatcaaaaaccatttgatgtgtgaagaaatccacaagcgttttcatttgcac
cccaaagtgaggaaggctatggagagtattgaaagggaagtttttgtgccagcccccttt
aaacactttgcctacactttaaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaatcgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggtgctgtctcaaattttcaggcgcgtt
tttagcattgaaaggattgagagcctgtatttagaagcccgtttgcgccttaaaactctg
ggtttagacaatgttcatgttaaattcgctgatgggaataagggttgggatcaatacgcc
ccctatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgcttattgat
cagcttgaagaaggcgggattttagttgcgcccattcaagaaaataacgagcaagtcatc
aaacgctttgtgaagcaaaataacgccttgcgcgtccaaaaagtgttagaaaaatgctcg
tttgtgcctattgtagatggggtgcaataa

DBGET integrated database retrieval system