KEGG   Helicobacter pylori India7: HPIN_05490Help
Entry
HPIN_05490        CDS       T01918                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00010  Glycolysis / Gluconeogenesis
hpn00020  Citrate cycle (TCA cycle)
hpn00620  Pyruvate metabolism
hpn00640  Propanoate metabolism
hpn00650  Butanoate metabolism
hpn00680  Methane metabolism
hpn01100  Metabolic pathways
hpn01120  Microbial metabolism in diverse environments
hpn01130  Biosynthesis of antibiotics
hpn01200  Carbon metabolism
Module
hpn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPIN_05490
   00020 Citrate cycle (TCA cycle)
    HPIN_05490
   00620 Pyruvate metabolism
    HPIN_05490
   00640 Propanoate metabolism
    HPIN_05490
   00650 Butanoate metabolism
    HPIN_05490
  Energy metabolism
   00680 Methane metabolism
    HPIN_05490
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPIN_05490
Enzymes [BR:hpn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPIN_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ADU80299
UniProt: E8QH37
Position
1121613..1122557
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGFQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHVIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaatttcaaggc
tcgcacttgctttgtccgggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggatccatattggttttgaaaacggctctacg
gcgatttcaggggtggaagcgatgtataaagcgttagtgaataagggccgctatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggccagttatgatattggttttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcttagataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccgttaggggctagcacttct
accacgccagcaggatcggtgagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggcgttccttatgtggcacaactctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcgctagacactgaagggccttgctttattaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccctatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaagaaaacgaacatgttattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgccgagaagaagctaaagtataa

DBGET integrated database retrieval system