KEGG   Helicobacter pylori India7: HPIN_06170Help
Entry
HPIN_06170        CDS       T01918                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpn  Helicobacter pylori India7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPIN_06170 (tpiA)
   01230 Biosynthesis of amino acids
    HPIN_06170 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPIN_06170 (tpiA)
   00051 Fructose and mannose metabolism
    HPIN_06170 (tpiA)
   00562 Inositol phosphate metabolism
    HPIN_06170 (tpiA)
Enzymes [BR:hpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPIN_06170 (tpiA)
Exosome [BR:hpn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPIN_06170 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPIN_06170 (tpiA)
  Exosomal proteins of melanoma cells
   HPIN_06170 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1248776..1249480)
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIRTLLIGHSERRTLLKESPSFLKEKFDFFKDKNFKIVY
CIGEELTTREKGFKAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgacagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ttaaaaatccgcacgcttttaatagggcatagcgagaggcgaacgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaagataaaaattttaaaattgtctat
tgtattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagacatttatctcacgcatggt
tttttaaagcaaattttaaaccaaaaaacgcccttattgtatggggggagcgtgaacaca
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system