KEGG   Helicobacter pylori India7: HPIN_06170Help
Entry
HPIN_06170        CDS       T01918                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00010  Glycolysis / Gluconeogenesis
hpn00051  Fructose and mannose metabolism
hpn01100  Metabolic pathways
hpn01110  Biosynthesis of secondary metabolites
hpn01120  Microbial metabolism in diverse environments
hpn01130  Biosynthesis of antibiotics
hpn01200  Carbon metabolism
hpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPIN_06170 (tpiA)
   00051 Fructose and mannose metabolism
    HPIN_06170 (tpiA)
   00562 Inositol phosphate metabolism
    HPIN_06170 (tpiA)
Enzymes [BR:hpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPIN_06170 (tpiA)
Exosome [BR:hpn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPIN_06170 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPIN_06170 (tpiA)
  Exosomal proteins of melanoma cells
   HPIN_06170 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU80428
UniProt: E8QHG6
Structure
PDB: 

Jmol
Position
complement(1248776..1249480)
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIRTLLIGHSERRTLLKESPSFLKEKFDFFKDKNFKIVY
CIGEELTTREKGFKAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgacagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ttaaaaatccgcacgcttttaatagggcatagcgagaggcgaacgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaagataaaaattttaaaattgtctat
tgtattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagacatttatctcacgcatggt
tttttaaagcaaattttaaaccaaaaaacgcccttattgtatggggggagcgtgaacaca
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system