KEGG   Helicobacter pylori India7: HPIN_06500Help
Entry
HPIN_06500        CDS       T01918                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpn  Helicobacter pylori India7
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314665..1315807
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKSALQKIGPEKIAQNHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSANQLERLIMKCHSQPFGLKNLAQELKSHLKAKKPNAPQ
IMAVLNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPESEIIDPKIEQDR
LKEVLLEIKSQKLYQCAQFSIDTYHATTAQMALEHYFSILNDVSGFSSIEMLEVARDYKP
TCVLMHAKKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEETE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaagcgctctacaaaaaataggccca
gaaaagatcgcacaaaaccatatgcgccaaaaaggcgttagctttgtttttgaaatccaa
catctgcccttaagcgctgcactcattttaaagcaagaagccataagcgttgggggcgat
tttgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttgatt
gttagcgctaaccagttagaacgccttattatgaagtgccattcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccacctcaaagctaaaaaacctaacgccccacag
atcatggcggttttaaacctgactccggatagtttctatgaaaagagccggtttgatagc
aaaaaagcgcttgaagagatctatcaattgctagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccagagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaagttttattagaaatcaaatcccaaaaactctaccaatgcgctcaattcagc
atagacacctaccatgccacaaccgcgcaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttagtagtattgaaatgctagaagtcgccagagattataaaccc
acttgcgttttaatgcacgctaaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaattagaggttttagaaaaa
tacgcgcttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaagaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcactgggcgtgaagttcaaaaccggctt
gctggcactttgagtttgcatttaatggcgttgcaaaatggagcgagtattttaagagtg
catgacattgatgagcatatagacctcatcaaagtgtttaagagtttagaagaaacggaa
tga

DBGET integrated database retrieval system