KEGG   Helicobacter pylori India7: HPIN_06730Help
Entry
HPIN_06730        CDS       T01918                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpn  Helicobacter pylori India7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPIN_06730
   00030 Pentose phosphate pathway
    HPIN_06730
   00051 Fructose and mannose metabolism
    HPIN_06730
   00052 Galactose metabolism
    HPIN_06730
   00500 Starch and sucrose metabolism
    HPIN_06730
   00520 Amino sugar and nucleotide sugar metabolism
    HPIN_06730
  Nucleotide metabolism
   00230 Purine metabolism
    HPIN_06730
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPIN_06730
Enzymes [BR:hpn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPIN_06730
    5.4.2.8  phosphomannomutase
     HPIN_06730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1359526..1360929
Genome map
AA seq 467 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKGAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFVAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKNTLLNAKHEIKPLKETPEKANALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGTTPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKVKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEEQGSKPIKHQ
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagggaatatgatattagaggcatttaccccaccactttagat
gagaagggggcttttagtatcggtgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgtggcctttaatgaaatagacaatatccaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaaaacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccagagaaagccaacgccctagaagcgtatcaccgctatttg
atcaaggattttaagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagatcctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggataggattgcgatgttaagctctcaccatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcaccactccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacctttggtaagacgctcatg
tataaaaccgggcacagcaatttaaaagtcaaactcaaagaaaccaacgcacattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgctcgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagcgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggt
tttggacttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacagcgttagaatataaaagggcgttgctcaatttgctagaggaacaaggc
tctaaaccaatcaaacaccaataa

DBGET integrated database retrieval system