KEGG   Helicobacter pylori India7: HPIN_06735Help
Entry
HPIN_06735        CDS       T01918                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpn  Helicobacter pylori India7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPIN_06735 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPIN_06735 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPIN_06735 (trpA)
Enzymes [BR:hpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPIN_06735 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1361504..1362292)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQDKMAFIPFVTLGDPNYALSFEIIKTLIASGVSALELGLAFSDPVADG
VTIQASHLRALKHASMAKNFQLLKKIRGYNHDIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASSKDLEQAAMHSQGYIYTLARSGV
TGASCILENDASAIIKTLKAFSPTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIESFVREMVG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttattccg
tttgtaactttgggtgatcccaattatgcattgagttttgaaatcattaaaaccctaatt
gctagcggggtgagcgctttagaattggggttggctttctccgatcctgtagcggatggt
gttaccatacaagcgagccatttaagagcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagaggctacaaccatgatattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgctcaaatcaaagaatgcggc
gtggatagcgttttgatagcggacatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaaacaaatctttatcgccagccctaatgcgagcagtaaggat
ttagaacaagccgctatgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggagcgagttgtattttagaaaatgacgcgagcgctattattaaaaccttaaaagcc
tttagtcccaccccagccttactgggctttggcatttctaaaaaagaacacatcacaaac
gctaaaggcatgggtgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttaaacaacgaaaacgccatgctggaaaaaattgagagttttgtgagagagatg
gttggttga

DBGET integrated database retrieval system