KEGG   Helicobacter pylori India7: HPIN_07415Help
Entry
HPIN_07415        CDS       T01918                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpn  Helicobacter pylori India7
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPIN_07415
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPIN_07415
Enzymes [BR:hpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPIN_07415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1481795..1482763
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEMDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVGAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLGAIEVTEYNPTVSVKHTNEEEKQVLE
ILDLIINSCKIKDKKPSFAMSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttgagcgccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagttcagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgaaaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaggcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgattcaaaacatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctcgttggggttagaaaagggagggttggaaatggatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtgggtgcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatttagacattatggacggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactgggcttgcttttagaaagttttaaagaccgattaggagcgattgaagtaacc
gaatacaaccccacggtgagcgtaaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttgcaatg
agttactga

DBGET integrated database retrieval system