KEGG   Helicobacter pylori India7: HPIN_07905Help
Entry
HPIN_07905        CDS       T01918                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00900  Terpenoid backbone biosynthesis
hpn01100  Metabolic pathways
hpn01110  Biosynthesis of secondary metabolites
hpn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPIN_07905
Enzymes [BR:hpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPIN_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADU80765
UniProt: E8QEI8
Position
complement(1590239..1591042)
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPLE
KNSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLKELYSMGSLVGADTNFFISQYKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNGLNDLLKPALLTNQALRSIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgaagtttatcctaaagtcaatatttttttaaagatccttcacaaagaa
ggggcttaccataagctcatttctcgcatgtgtttggtcaaagataagttaaaggatatt
atcagcgtcaaaagtgcgctttccttttcactcaaaggggattttgactgccctttagaa
aaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagtgctgatgctggggggctattgtatcatctgaat
cagatttttgactggcgtttgagtttaaaagagctttatagcatgggatctttagtgggc
gcggacaccaattttttcatctcgcaatacaaaagtgctaacgctacttcttatggcgaa
gtcattgaaaattttgaagaagagcctttagaaaaccgcctagaaatctatgcaccaaat
catgttttttgcagcactaaagctatctatcaagcttataaacctgaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttgcgacagaaac
ggattaaacgatcttttaaaaccggctttactcactaaccaagctttaagaagtatagaa
agtgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgctaaaagggggcgaatga

DBGET integrated database retrieval system