KEGG   Helicobacter pylori 35A: HMPREF4655_20057Help
Entry
HMPREF4655_20057  CDS       T01892                                 

Gene name
ccpA
Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpo  Helicobacter pylori 35A
Brite
Enzymes [BR:hpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HMPREF4655_20057 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48582..49634
Genome map
AA seq 350 aa AA seqDB search
MKKSILLSAFLAFSCAHALNDMDLIKKARESQLEPMPMGKALKEYQIKKTKDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLIPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVAEKINSMPGYVKLFRKAYG
TKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIEIFFEALKGKKPKILYPELPVITDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgagtgcctttttagccttttcttgcgctcatgctttaaac
gatatggatttgatcaaaaaagcgagggaaagccaattagagcctatgcctatgggcaaa
gcgctcaaagaataccagattaaaaaaactaaagatgtgggtattggcaccaaaaacagc
gagattatgacccccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttaatcccaagtgctgtaggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaatgatgtgcagttttgggatgggagagttacgcattta
aacgaacaagcgcaagggcccatccagtcttcttttgaaatgggggctgatcctaaagtg
gtggcagaaaaaatcaattccatgccaggctatgtcaaactctttagaaaagcttatggc
actaaagtcaaaattgattttaaattgatcgcagatagtatcgctatgtttgaagccacg
cttatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gctgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataatgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
attttctttgaagccctaaagggtaaaaaacctaaaatactctatccagaactccctgta
ataacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system